Q6RY07 · CHIA_RAT
- ProteinAcidic mammalian chitinase
- GeneChia
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids473 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding (By similarity).
Catalytic activity
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 70-71 | chitin (UniProtKB | ChEBI) | ||||
Sequence: EW | ||||||
Binding site | 97-100 | chitin (UniProtKB | ChEBI) | ||||
Sequence: GGWN | ||||||
Active site | 140 | Proton donor | ||||
Sequence: E | ||||||
Binding site | 141 | chitin (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Binding site | 210-213 | chitin (UniProtKB | ChEBI) | ||||
Sequence: MTYD | ||||||
Binding site | 360 | chitin (UniProtKB | ChEBI) | ||||
Sequence: W |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | chitin binding | |
Molecular Function | chitinase activity | |
Molecular Function | kinase binding | |
Biological Process | apoptotic process | |
Biological Process | chitin catabolic process | |
Biological Process | immune system process | |
Biological Process | polysaccharide catabolic process | |
Biological Process | positive regulation of chemokine production | |
Biological Process | production of molecular mediator involved in inflammatory response |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAcidic mammalian chitinase
- EC number
- Short namesAMCase
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ6RY07
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MAKLILVTGLVLLLNVQLGSA | ||||||
Chain | PRO_0000011946 | 22-473 | Acidic mammalian chitinase | |||
Sequence: YNLVCYFTNWAQYRPGLGSFKPDDINPCLCTHLIYAFAGMQNNQITTIEWNDVTLYKAFNDLKNRNSKLKTLLAIGGWNFGTAPFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKHLFTVLVKELREAFEQEAIESNRPRLMVTAAVAAGISNIQAGYEIPELSQYLDFIHVMTYDLHGSWDGYTGENSPLYKLPTETGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPEYGHTYILSNPSDTGIGAPTSGNGPAGPYTRQAGFWAYYEICTFLRNGATQDWDAPQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLNKALDIPTAGCTAPDLPSEPVTTPPGSGSGGGSSGGGSEGSGFCAGKADGLYPVADDRNAFWHCINGITYQQHCQAGLVFDTSCNCCNWP | ||||||
Disulfide bond | 26↔51 | |||||
Sequence: CYFTNWAQYRPGLGSFKPDDINPCLC | ||||||
Disulfide bond | 49↔394 | |||||
Sequence: CLCTHLIYAFAGMQNNQITTIEWNDVTLYKAFNDLKNRNSKLKTLLAIGGWNFGTAPFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKHLFTVLVKELREAFEQEAIESNRPRLMVTAAVAAGISNIQAGYEIPELSQYLDFIHVMTYDLHGSWDGYTGENSPLYKLPTETGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPEYGHTYILSNPSDTGIGAPTSGNGPAGPYTRQAGFWAYYEICTFLRNGATQDWDAPQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLNKALDIPTAGC | ||||||
Disulfide bond | 307↔372 | |||||
Sequence: CTFLRNGATQDWDAPQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFC | ||||||
Disulfide bond | 457↔470 | |||||
Sequence: CQAGLVFDTSCNCC |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 22-390 | GH18 | ||||
Sequence: YNLVCYFTNWAQYRPGLGSFKPDDINPCLCTHLIYAFAGMQNNQITTIEWNDVTLYKAFNDLKNRNSKLKTLLAIGGWNFGTAPFTTMVSTSQNRQTFITSVIKFLRQYGFDGLDLDWEYPGSRGSPPQDKHLFTVLVKELREAFEQEAIESNRPRLMVTAAVAAGISNIQAGYEIPELSQYLDFIHVMTYDLHGSWDGYTGENSPLYKLPTETGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPEYGHTYILSNPSDTGIGAPTSGNGPAGPYTRQAGFWAYYEICTFLRNGATQDWDAPQEVPYAYKGNEWVGYDNIKSFSVKAQWLKQNNFGGAMIWAIDLDDFTGSFCDQGKFPLTSTLNKALDIP | ||||||
Region | 395-421 | Disordered | ||||
Sequence: TAPDLPSEPVTTPPGSGSGGGSSGGGS | ||||||
Compositional bias | 405-419 | Polar residues | ||||
Sequence: TTPPGSGSGGGSSGG | ||||||
Domain | 424-473 | Chitin-binding type-2 | ||||
Sequence: SGFCAGKADGLYPVADDRNAFWHCINGITYQQHCQAGLVFDTSCNCCNWP |
Sequence similarities
Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length473
- Mass (Da)51,951
- Last updated2004-07-05 v1
- ChecksumFBB0DB91A42C1EFD
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2K676 | A0A0G2K676_RAT | Chia | 510 | ||
F1LPK5 | F1LPK5_RAT | Chia | 359 | ||
A0A8I5Y1C5 | A0A8I5Y1C5_RAT | Chia | 455 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 405-419 | Polar residues | ||||
Sequence: TTPPGSGSGGGSSGG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY486074 EMBL· GenBank· DDBJ | AAR28968.1 EMBL· GenBank· DDBJ | mRNA |