Q6PI25 · CNIH2_HUMAN
- ProteinProtein cornichon homolog 2
- GeneCNIH2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids160 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by regulating their rates of activation, deactivation and desensitization. Blocks CACNG8-mediated resensitization of AMPA receptors.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | AMPA glutamate receptor complex | |
Cellular Component | dendrite | |
Cellular Component | dendritic shaft | |
Cellular Component | dendritic spine | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | endoplasmic reticulum-Golgi intermediate compartment membrane | |
Cellular Component | ER to Golgi transport vesicle membrane | |
Cellular Component | postsynaptic density | |
Cellular Component | postsynaptic membrane | |
Cellular Component | synapse | |
Biological Process | regulation of AMPA receptor activity | |
Biological Process | vesicle-mediated transport |
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameProtein cornichon homolog 2
- Short namesCNIH-2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ6PI25
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Postsynaptic cell membrane ; Multi-pass membrane protein
Note: Also localizes to the cell membrane of extrasynaptic sites (dendritic shafts, spines of pyramidal cells).
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-10 | Cytoplasmic | ||||
Sequence: MAFTFAAFCY | ||||||
Transmembrane | 11-31 | Helical | ||||
Sequence: MLTLVLCASLIFFVIWHIIAF | ||||||
Topological domain | 32-72 | Lumenal | ||||
Sequence: DELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEY | ||||||
Transmembrane | 73-93 | Helical | ||||
Sequence: SIHGLFCLMFLCAAEWVTLGL | ||||||
Topological domain | 94-138 | Cytoplasmic | ||||
Sequence: NIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCK | ||||||
Transmembrane | 139-159 | Helical | ||||
Sequence: LAFYLLSFFYYLYSMVYTLVS | ||||||
Topological domain | 160 | Lumenal | ||||
Sequence: F |
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 104 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000122225 | 1-160 | Protein cornichon homolog 2 | |||
Sequence: MAFTFAAFCYMLTLVLCASLIFFVIWHIIAFDELRTDFKNPIDQGNPARARERLKNIERICCLLRKLVVPEYSIHGLFCLMFLCAAEWVTLGLNIPLLFYHLWRYFHRPADGSEVMYDAVSIMNADILNYCQKESWCKLAFYLLSFFYYLYSMVYTLVSF |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expression is up-regulated in dorsolateral prefrontal cortex of patients with schizophrenia (postmortem brain study).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Acts as an auxiliary subunit for AMPA-selective glutamate receptors (AMPARs). Found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, CNIH3, CACNG2, CACNG3, CACNG4, CACNG5, CACNG7 and CACNG8 (By similarity).
Interacts with CACGN8 (By similarity).
Interacts with GRIA1. Found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, DLG4 and CACNG8 (By similarity).
Interacts with CACGN8 (By similarity).
Interacts with GRIA1. Found in a complex with GRIA1, GRIA2, GRIA3, GRIA4, DLG4 and CACNG8 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q6PI25 | CD53 P19397 | 3 | EBI-12815321, EBI-6657396 | |
BINARY | Q6PI25 | CREB3L1 Q96BA8 | 3 | EBI-12815321, EBI-6942903 | |
BINARY | Q6PI25 | GORAB Q5T7V8 | 3 | EBI-12815321, EBI-3917143 | |
BINARY | Q6PI25 | HIBADH P31937 | 3 | EBI-12815321, EBI-11427100 | |
BINARY | Q6PI25 | TMEM14B Q9NUH8 | 3 | EBI-12815321, EBI-8638294 | |
BINARY | Q6PI25 | TMPRSS2 O15393-2 | 3 | EBI-12815321, EBI-12345267 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length160
- Mass (Da)18,931
- Last updated2004-07-05 v1
- Checksum00330E5E609B28BF
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC047953 EMBL· GenBank· DDBJ | AAH47953.1 EMBL· GenBank· DDBJ | mRNA |