Q6PFY1 · FCSD1_MOUSE
- ProteinF-BAR and double SH3 domains protein 1
- GeneFchsd1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids688 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Promotes actin polymerization mediated by SNX9 and WASL.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell projection | |
Cellular Component | neuromuscular junction | |
Cellular Component | perikaryon | |
Cellular Component | recycling endosome | |
Molecular Function | lipid binding | |
Biological Process | membrane organization | |
Biological Process | neuromuscular synaptic transmission | |
Biological Process | positive regulation of actin filament polymerization | |
Biological Process | regulation of actin filament polymerization |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameF-BAR and double SH3 domains protein 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ6PFY1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Detected on neuronal cell bodies and cell projections, in part on cytoplasmic vesicles.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000278213 | 1-688 | F-BAR and double SH3 domains protein 1 | |||
Sequence: MQPPPRKVKPAQEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQRAAIEREYGQALQKLAGPFLKREGQRSGEADSRTVFGAWRCLLDATVAGGQTRLQASDRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHLAHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQDVKLFLQGPGVFSPTPPQQFQPAGADQVCGLEWGAGGMAGESGLEKEVQRWTSRAARDYKIQHHGHRVLQRLEQRRQQAPGREAPGVEQRLQEVRENIRRAQVSQVKGAARLALLQEAGLDVQRWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFDECEEAGELFEEPAPPALATRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARNQHGEAGFVPERYLNFPDLSLPESCHGIDNPSGGEPTAFLARALYSYTGQSEEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGPPELSDPEQMLPSPSPPSFSPPAPTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDPLT | ||||||
Modified residue | 442 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in inner ear vestibula and in the cuticular plate of cochlear hair cells (at protein level). Ubiquitous. Detected in testis, liver, brain cortex, cerebellum, spiral ganglion and tongue, and at lower levels in the organ of Corti and utricle in the inner ear.
Developmental stage
Detected in brain cortex at 15.5 dpc. Highly expressed in brain cortex from young and adult animals (at protein level).
Gene expression databases
Interaction
Subunit
Homodimer (Probable). Interacts (via F-BAR domain) with SNX9 (via SH3 domain) (PubMed:23437151, PubMed:26567222).
Interacts (via F-BAR domain) with SNX18 and SNX33 (PubMed:26567222).
Interacts (via SH3 domain 1) with WASL (PubMed:29887380).
Interacts (via SH3 domain 2) with ITSN1 (PubMed:29887380).
Interacts (via F-BAR domain) with SNX18 and SNX33 (PubMed:26567222).
Interacts (via SH3 domain 1) with WASL (PubMed:29887380).
Interacts (via SH3 domain 2) with ITSN1 (PubMed:29887380).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, coiled coil, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 12-280 | F-BAR | ||||
Sequence: QEVKLRFLEQLSILQTRQQREADLLEDIRSYSKQRAAIEREYGQALQKLAGPFLKREGQRSGEADSRTVFGAWRCLLDATVAGGQTRLQASDRYRDLAGGTGRSAKEQVLRKGTESLQQAQAEVLQSVRELSRSRKLYGQRQRVWALAQEKAADVQARLNRSDHGIFHSRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLVATNAHLAHYYQEELPALLKVLVSELSEYLRDPLTLLGHTELEAAEMILEHARHGGKATSQVNWEQD | ||||||
Coiled coil | 360-386 | |||||
Sequence: GREAPGVEQRLQEVRENIRRAQVSQVK | ||||||
Domain | 466-527 | SH3 1 | ||||
Sequence: PLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARNQHGEAGFVPERYLNFPDL | ||||||
Domain | 544-607 | SH3 2 | ||||
Sequence: PTAFLARALYSYTGQSEEELSFPEGALIRLLPRAQDGVDDGFWRGEFGGHVGVFPSLLVEELLG | ||||||
Region | 607-688 | Disordered | ||||
Sequence: GPPGPPELSDPEQMLPSPSPPSFSPPAPTCALDGSTAPALPSDKVLDCPGPLDMMVPRLRPMRPPPPPPAKAPDPGHPDPLT | ||||||
Compositional bias | 610-633 | Pro residues | ||||
Sequence: GPPELSDPEQMLPSPSPPSFSPPA | ||||||
Compositional bias | 664-688 | Pro residues | ||||
Sequence: RLRPMRPPPPPPAKAPDPGHPDPLT |
Domain
The F-BAR domain has an atypical, flat shape and binds preferentially to flat membranes (By similarity).
Upon heterologous expression, the isolated F-BAR domain is localized at the cell membrane, and causes the formation of cellular protrusions (PubMed:23761074, PubMed:26567222).
Upon heterologous expression, the isolated F-BAR domain is localized at the cell membrane, and causes the formation of cellular protrusions (PubMed:23761074, PubMed:26567222).
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q6PFY1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length688
- Mass (Da)76,256
- Last updated2004-07-05 v1
- Checksum98A9293622D063F2
Q6PFY1-2
- Name2
- Differences from canonical
- 1-259: Missing
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_023166 | 1-259 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 610-633 | Pro residues | ||||
Sequence: GPPELSDPEQMLPSPSPPSFSPPA | ||||||
Compositional bias | 664-688 | Pro residues | ||||
Sequence: RLRPMRPPPPPPAKAPDPGHPDPLT |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK079461 EMBL· GenBank· DDBJ | BAC37653.1 EMBL· GenBank· DDBJ | mRNA | ||
BC057367 EMBL· GenBank· DDBJ | AAH57367.1 EMBL· GenBank· DDBJ | mRNA |