Q6P1K2 · PMF1_HUMAN
- ProteinPolyamine-modulated factor 1
- GenePMF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids205 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | Golgi apparatus | |
Cellular Component | intracellular membrane-bounded organelle | |
Cellular Component | kinetochore | |
Cellular Component | MIS12/MIND type complex | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | outer kinetochore | |
Cellular Component | spindle pole | |
Cellular Component | transcription regulator complex | |
Molecular Function | leucine zipper domain binding | |
Molecular Function | transcription coactivator activity | |
Biological Process | attachment of spindle microtubules to kinetochore | |
Biological Process | cell division | |
Biological Process | chromosome segregation | |
Biological Process | transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePolyamine-modulated factor 1
- Short namesPMF-1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ6P1K2
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Associated with the kinetochore.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_034147 | 75 | in dbSNP:rs1052053 | |||
Sequence: Q → R | ||||||
Natural variant | VAR_034148 | 137 | in dbSNP:rs1052067 | |||
Sequence: M → I |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 268 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000248237 | 1-205 | UniProt | Polyamine-modulated factor 1 | |||
Sequence: MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE | |||||||
Modified residue (large scale data) | 6 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 11 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Highest levels of expression in heart and skeletal muscle, with significant levels expressed in kidney and liver.
Induction
By polyamine analogs in analog-sensitive H157 cells.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the MIS12 complex composed of MIS12, DSN1, NSL1 and PMF1. Interacts with COPS7A. Interacts via its coiled-coil domain with the leucine-zipper domain of NFE2L2. The interaction with NFE2L2 is required for the transcriptional regulation of SSAT.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-30 | Disordered | ||||
Sequence: MAEASSANLGSGCEEKRHEGSSSESVPPGT | ||||||
Coiled coil | 141-193 | |||||
Sequence: FLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHRE |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 6 isoforms produced by Alternative splicing.
Q6P1K2-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length205
- Mass (Da)23,339
- Last updated2006-09-05 v2
- ChecksumDAE3A0BF43F14820
Q6P1K2-2
- Name2
- Differences from canonical
- 55-89: YQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIR → SPLLHWDGSAGPRLPSGGQSVKQAFSWAACRLPQGRK
Q6P1K2-3
- Name3
Q6P1K2-4
- Name4
- Differences from canonical
- 1-40: Missing
Q6P1K2-5
- Name5
- Differences from canonical
- 123-205: WRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE → CNGTPCGAMCRNRRPRTSSWQMPSWQGGGRWRSCSYRSRPSSRPGRCEAQRCRVQQRCSLCVQAGGQRGSEETQALPVSMAGSPSPLPGSPGAQEGGV
Q6P1K2-6
- Name6
- Differences from canonical
- 123-205: WRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE → CNGTPCGAMCRNRRPRTSSWQMPSWQGGGRWRSCSYRSRPSSRPGRLYTENRGSWLLC
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_052136 | 1-40 | in isoform 4 | |||
Sequence: Missing | ||||||
Sequence conflict | 2 | in Ref. 6; CAH10730 | ||||
Sequence: A → G | ||||||
Alternative sequence | VSP_052137 | 55-89 | in isoform 2 | |||
Sequence: YQRFTDCYKCFYQLQPAMTQQIYDKFIAQLQTSIR → SPLLHWDGSAGPRLPSGGQSVKQAFSWAACRLPQGRK | ||||||
Alternative sequence | VSP_052138 | 123-205 | in isoform 5 | |||
Sequence: WRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE → CNGTPCGAMCRNRRPRTSSWQMPSWQGGGRWRSCSYRSRPSSRPGRCEAQRCRVQQRCSLCVQAGGQRGSEETQALPVSMAGSPSPLPGSPGAQEGGV | ||||||
Alternative sequence | VSP_044638 | 123-205 | in isoform 6 | |||
Sequence: WRPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE → CNGTPCGAMCRNRRPRTSSWQMPSWQGGGRWRSCSYRSRPSSRPGRLYTENRGSWLLC | ||||||
Alternative sequence | VSP_052139 | 124-175 | in isoform 3 | |||
Sequence: RPSGIPEKDLHSVMAPYFLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEE → CEAQRCRVQQRCSLCVQAGGQRGSEETQALPVSMAGSPSPLPGSPGAQEGGV | ||||||
Alternative sequence | VSP_052140 | 176-205 | in isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF141309 EMBL· GenBank· DDBJ | AAD50080.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF141308 EMBL· GenBank· DDBJ | AAD50080.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF141310 EMBL· GenBank· DDBJ | AAD50081.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK124646 EMBL· GenBank· DDBJ | BAC85916.1 EMBL· GenBank· DDBJ | mRNA | ||
AK289490 EMBL· GenBank· DDBJ | BAF82179.1 EMBL· GenBank· DDBJ | mRNA | ||
AK290260 EMBL· GenBank· DDBJ | BAF82949.1 EMBL· GenBank· DDBJ | mRNA | ||
AL135927 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471121 EMBL· GenBank· DDBJ | EAW52989.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471121 EMBL· GenBank· DDBJ | EAW52990.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC033656 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BC050735 EMBL· GenBank· DDBJ | AAH50735.1 EMBL· GenBank· DDBJ | mRNA | ||
BC056417 EMBL· GenBank· DDBJ | AAH56417.1 EMBL· GenBank· DDBJ | mRNA | ||
BC065031 EMBL· GenBank· DDBJ | AAH65031.1 EMBL· GenBank· DDBJ | mRNA | ||
AL080101 EMBL· GenBank· DDBJ | CAH10730.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |