Q6NME6 · RLF19_ARATH
- ProteinProtein RALF-like 19
- GeneRALFL19
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids110 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Cell signaling peptide that may regulate plant stress, growth, and development. Mediates a rapid alkalinization of extracellular space by mediating a transient increase in the cytoplasmic Ca2+ concentration leading to a calcium-dependent signaling events through a cell surface receptor and a concomitant activation of some intracellular mitogen-activated protein kinases (By similarity).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 54-55 | Required for proteolytic cleavage | ||||
Sequence: RR |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Cellular Component | pollen tube | |
Molecular Function | hormone activity | |
Biological Process | calcium-mediated signaling | |
Biological Process | cell-cell signaling | |
Biological Process | regulation of pollen tube growth |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameProtein RALF-like 19
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ6NME6
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, propeptide, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MGIKILLILGLLTLAVVAESANA | ||||||
Propeptide | PRO_0000420312 | 24-58 | Removed in mature form | |||
Sequence: TWTLTKSCVNGQGCIGEDGELDYLMDSETNRRQLA | ||||||
Chain | PRO_0000420313 | 59-110 | Protein RALF-like 19 | |||
Sequence: ARRSYISYGALRKNNVPCSRRGRSYYDCKKRKRANPYRRGCSVITHCYRQTS | ||||||
Disulfide bond | 76↔86 | |||||
Sequence: CSRRGRSYYDC | ||||||
Disulfide bond | 99↔105 | |||||
Sequence: CSVITHC |
Post-translational modification
Proteolytically cleaved, probably by S1P, a subtilisin-like serine protease (subtilase).
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length110
- Mass (Da)12,397
- Last updated2004-07-05 v1
- Checksum964FF55E9E94A162
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 80 | in Ref. 4; BAD94374 | ||||
Sequence: G → D |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U78721 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CP002685 EMBL· GenBank· DDBJ | AEC08883.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT011714 EMBL· GenBank· DDBJ | AAS49077.1 EMBL· GenBank· DDBJ | mRNA | ||
AK220918 EMBL· GenBank· DDBJ | BAD94374.1 EMBL· GenBank· DDBJ | mRNA |