Q6K7S7 · CCMH_ORYSJ
- ProteinCytochrome c-type biogenesis CcmH-like mitochondrial protein
- GeneCCMH
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids152 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
Plays a role in mitochondrial cytochrome c maturation. Probable component of a heme lyase complex involved in the reduction of apocytochrome c.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial inner membrane | |
Cellular Component | protein-containing complex | |
Molecular Function | metal ion binding | |
Molecular Function | oxidoreductase activity | |
Biological Process | cytochrome complex assembly | |
Biological Process | embryo development ending in seed dormancy |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameCytochrome c-type biogenesis CcmH-like mitochondrial protein
- Short namesOsCCMH
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ6K7S7
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Single-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-83 | Mitochondrial intermembrane | ||||
Sequence: MATEEDVKQRQIIESRARNISHNVRCTECGSQSIEDSQADIAILLRKLIRDEIKSGKSDKEIYKKLQADYGETILYTPKFDLQ | ||||||
Transmembrane | 84-104 | Helical | ||||
Sequence: TAAIWLSPVIVGGVAAGVWAY | ||||||
Topological domain | 105-152 | Mitochondrial matrix | ||||
Sequence: QKHRQRTNVHIMALNLVRGVPLTPREKETMLDVLTPPPPANKWWWPGK |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000432847 | 1-152 | Cytochrome c-type biogenesis CcmH-like mitochondrial protein | |||
Sequence: MATEEDVKQRQIIESRARNISHNVRCTECGSQSIEDSQADIAILLRKLIRDEIKSGKSDKEIYKKLQADYGETILYTPKFDLQTAAIWLSPVIVGGVAAGVWAYQKHRQRTNVHIMALNLVRGVPLTPREKETMLDVLTPPPPANKWWWPGK |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length152
- Mass (Da)17,278
- Last updated2004-07-05 v1
- ChecksumBDAF91EA713DBF81
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP004770 EMBL· GenBank· DDBJ | BAD21809.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP004771 EMBL· GenBank· DDBJ | BAD21845.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008208 EMBL· GenBank· DDBJ | BAF08453.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014958 EMBL· GenBank· DDBJ | BAS78087.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000139 EMBL· GenBank· DDBJ | EEE56726.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK242385 EMBL· GenBank· DDBJ | BAH01276.1 EMBL· GenBank· DDBJ | mRNA |