Q6K0P9 · IFIX_HUMAN
- ProteinPyrin and HIN domain-containing protein 1
- GenePYHIN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids492 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Major mediator of the tumor suppressor activity of IFN in breast cancer cells. Promotes ubiquitination and subsequent degradation of MDM2, which leads to p53/TP53 stabilization. Promotes ubiquitination and subsequent degradation of HDAC1, which in turn enhances maspin expression, and impairs invasive activity of cancer cells.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nuclear speck | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | protein-containing complex | |
Molecular Function | double-stranded DNA binding | |
Molecular Function | ubiquitin protein ligase binding | |
Biological Process | activation of innate immune response | |
Biological Process | cellular response to interferon-alpha | |
Biological Process | cellular response to interferon-beta | |
Biological Process | positive regulation of DNA binding | |
Biological Process | positive regulation of DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of protein localization to nucleus | |
Biological Process | positive regulation of ubiquitin-dependent protein catabolic process | |
Biological Process | protein destabilization | |
Biological Process | protein stabilization |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePyrin and HIN domain-containing protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ6K0P9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 698 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000334524 | 1-492 | UniProt | Pyrin and HIN domain-containing protein 1 | |||
Sequence: MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKLKVANKIESIPVKGIIPSKKTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFHATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSLLEVNEASSVSEAGPDQTFEVPKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGECHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQKNTNQRSHDSRSMALPQEQSQHPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP | |||||||
Modified residue (large scale data) | 176 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 464 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in spleen, lymph node and peripheral blood leukocytes, and at lower levels in thymus, bone marrow and fetal liver. Down-regulated in breast tumors.
Induction
By IFN-alphas and IFNG/IFN-gamma in hematopoietic cancer cells.
Gene expression databases
Organism-specific databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-88 | Pyrin | ||||
Sequence: MANNYKKIVLLKGLEVINDYHFRIVKSLLSNDLKLNPKMKEEYDKIQIADLMEEKFPGDAGLGKLIEFFKEIPTLGDLAETLKREKLK | ||||||
Region | 106-199 | Disordered | ||||
Sequence: KTKQKEVYPATPACTPSNRLTAKGAEETLGPQKRKKPSEEETGTKRSKMSKEQTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLA | ||||||
Compositional bias | 133-157 | Basic and acidic residues | ||||
Sequence: TLGPQKRKKPSEEETGTKRSKMSKE | ||||||
Compositional bias | 158-199 | Polar residues | ||||
Sequence: QTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLA | ||||||
Domain | 199-399 | HIN-200 | ||||
Sequence: ANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFHATVATQTQFFHVKVLNINLKRKFIKKRIIIISNYSKRNSLLEVNEASSVSEAGPDQTFEVPKDIIRRAKKIPKINILHKQTSGYIVYGLFMLHTKIVNRKTTIYEIQDKTGSMAVVGKGECHNIPCEKGDKLRLFCFRLRKRENMSKLMSEMHSFIQIQ | ||||||
Region | 400-492 | Disordered | ||||
Sequence: KNTNQRSHDSRSMALPQEQSQHPKPSEASTTLPESHLKTPQMPPTTPSSSSFTKKDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP |
Domain
The HIN-200 domain mediates interaction with MDM2.
Sequence similarities
Belongs to the HIN-200 family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 6 isoforms produced by Alternative splicing.
Q6K0P9-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Synonymsalpha1
- Length492
- Mass (Da)55,065
- Last updated2004-07-05 v1
- Checksum8711AABB92477D10
Q6K0P9-2
- Name2
- Synonymsalpha2
- Differences from canonical
- 89-97: Missing
Q6K0P9-3
- Name3
- Synonymsbeta1
- Differences from canonical
- 454-492: KDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP → VTKDKDIK
Q6K0P9-4
- Name4
- Synonymsbeta2
Q6K0P9-5
- Name5
- Synonymsgamma1
Q6K0P9-6
- Name6
- Synonymsgamma2
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
X6RHR0 | X6RHR0_HUMAN | PYHIN1 | 150 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_033657 | 89-97 | in isoform 2, isoform 4 and isoform 6 | |||
Sequence: Missing | ||||||
Compositional bias | 133-157 | Basic and acidic residues | ||||
Sequence: TLGPQKRKKPSEEETGTKRSKMSKE | ||||||
Compositional bias | 158-199 | Polar residues | ||||
Sequence: QTRPSCSAGASTSTAMGRSPPPQTSSSAPPNTSSTESLKPLA | ||||||
Alternative sequence | VSP_033658 | 194-245 | in isoform 5 and isoform 6 | |||
Sequence: SLKPLANRHATASKNIFREDPIIAMVLNATKVFKYESSENEQRRMFHATVAT → AYLMNLTLSLTAGSFLSCAVWGRDRELRNLELSATDSLSTAPIYYTPIPFAH | ||||||
Alternative sequence | VSP_033659 | 246-492 | in isoform 5 and isoform 6 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_033660 | 454-492 | in isoform 3 and isoform 4 | |||
Sequence: KDETHPGAQSSPANFRITSPTVAPPLSSDTSTNRHPAVP → VTKDKDIK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY185344 EMBL· GenBank· DDBJ | AAO67506.1 EMBL· GenBank· DDBJ | mRNA | ||
AY185345 EMBL· GenBank· DDBJ | AAO67507.1 EMBL· GenBank· DDBJ | mRNA | ||
AY185346 EMBL· GenBank· DDBJ | AAO67508.1 EMBL· GenBank· DDBJ | mRNA | ||
AY185347 EMBL· GenBank· DDBJ | AAO67509.1 EMBL· GenBank· DDBJ | mRNA | ||
AL359753 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471121 EMBL· GenBank· DDBJ | EAW52805.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC020822 EMBL· GenBank· DDBJ | AAH20822.1 EMBL· GenBank· DDBJ | mRNA | ||
BC090944 EMBL· GenBank· DDBJ | AAH90944.1 EMBL· GenBank· DDBJ | mRNA | ||
BC139741 EMBL· GenBank· DDBJ | AAI39742.1 EMBL· GenBank· DDBJ | mRNA |