Q6J9N8 · AIL7_ARATH
- ProteinAP2-like ethylene-responsive transcription factor AIL7
- GeneAIL7
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids498 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 231-297 | AP2/ERF 1 | ||||
Sequence: IYRGVTRHRWTGRYEAHLWDNSCRREGQARKGRQVYLGGYDKEDRAARAYDLAALKYWGSTATTNFP | ||||||
DNA binding | 333-391 | AP2/ERF 2 | ||||
Sequence: IYRGVTRHHQQGRWQARIGRVAGNKDLYLGTFATEEEAAEAYDIAAIKFRGINAVTNFE |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Biological Process | callus formation | |
Biological Process | ethylene-activated signaling pathway | |
Biological Process | lateral root formation | |
Biological Process | leaf phyllotactic patterning | |
Biological Process | maintenance of shoot apical meristem identity | |
Biological Process | phyllotactic patterning |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameAP2-like ethylene-responsive transcription factor AIL7
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionQ6J9N8
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000290367 | 1-498 | AP2-like ethylene-responsive transcription factor AIL7 | |||
Sequence: MAPPMTNCLTFSLSPMEMLKSTDQSHFSSSYDDSSTPYLIDNFYAFKEEAEIEAAAASMADSTTLSTFFDHSQTQIPKLEDFLGDSFVRYSDNQTETQDSSSLTPFYDPRHRTVAEGVTGFFSDHHQPDFKTINSGPEIFDDSTTSNIGGTHLSSHVVESSTTAKLGFNGDCTTTGGVLSLGVNNTSDQPLSCNNGERGGNSNKKKTVSKKETSDDSKKKIVETLGQRTSIYRGVTRHRWTGRYEAHLWDNSCRREGQARKGRQVYLGGYDKEDRAARAYDLAALKYWGSTATTNFPVSSYSKELEEMNHMTKQEFIASLRRKSSGFSRGASIYRGVTRHHQQGRWQARIGRVAGNKDLYLGTFATEEEAAEAYDIAAIKFRGINAVTNFEMNRYDIEAVMNSSLPVGGAAAKRHKLKLALESPSSSSSDHNLQQQQLLPSSSPSDQNPNSIPCGIPFEPSVLYYHQNFFQHYPLVSDSTIQAPMNQAEFFLWPNQSY |
Proteomic databases
Expression
Tissue specificity
Expressed in roots, seedlings, inflorescence, and siliques. Also detected at low levels in leaves.
Developmental stage
Confined to the central region of inflorescence ane floral meristems, progressively restricted to the innermost cells of the dome. Also detected in developing stamen locules and later in sporogonous cells within locules. In carpel primordia, found in placenta and in young ovule primordia.
Gene expression databases
Interaction
Subunit
Interacts with HDG2, and possibly with HDG3, HDG7, ANL2, ATML1 and PDF2.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 186-202 | Polar residues | ||||
Sequence: TSDQPLSCNNGERGGNS | ||||||
Region | 186-220 | Disordered | ||||
Sequence: TSDQPLSCNNGERGGNSNKKKTVSKKETSDDSKKK | ||||||
Compositional bias | 203-220 | Basic and acidic residues | ||||
Sequence: NKKKTVSKKETSDDSKKK | ||||||
Region | 422-452 | Disordered | ||||
Sequence: ESPSSSSSDHNLQQQQLLPSSSPSDQNPNSI |
Sequence similarities
Belongs to the AP2/ERF transcription factor family. AP2 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length498
- Mass (Da)55,448
- Last updated2011-05-31 v2
- Checksum8C35F55E0D0AF1FE
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8BA69 | A0A1P8BA69_ARATH | AIL7 | 440 | ||
A0A1P8BA85 | A0A1P8BA85_ARATH | AIL7 | 311 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 186-202 | Polar residues | ||||
Sequence: TSDQPLSCNNGERGGNS | ||||||
Compositional bias | 203-220 | Basic and acidic residues | ||||
Sequence: NKKKTVSKKETSDDSKKK |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB026639 EMBL· GenBank· DDBJ | BAA98170.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002688 EMBL· GenBank· DDBJ | AED98065.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002688 EMBL· GenBank· DDBJ | ANM68518.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY560887 EMBL· GenBank· DDBJ | AAT44954.1 EMBL· GenBank· DDBJ | mRNA |