Q6IGX9 · SIFA_DROME
- ProteinNeuropeptide SIFamide
- GeneSIFa
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Ligand for the neuropeptide SIFamide receptor (PubMed:16378592).
Modulates sexual behavior by negatively regulating female receptivity to male courtship and by playing a role in male sex discrimination (PubMed:17126293, PubMed:26469541).
Also involved in promoting sleep (PubMed:24658384).
Modulates sexual behavior by negatively regulating female receptivity to male courtship and by playing a role in male sex discrimination (PubMed:17126293, PubMed:26469541).
Also involved in promoting sleep (PubMed:24658384).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | hormone activity | |
Molecular Function | neuropeptide hormone activity | |
Molecular Function | neuropeptide receptor binding | |
Molecular Function | receptor ligand activity | |
Biological Process | mating behavior, sex discrimination | |
Biological Process | negative regulation of female receptivity | |
Biological Process | neuropeptide signaling pathway | |
Biological Process | positive regulation of circadian sleep/wake cycle, sleep | |
Biological Process | regulation of circadian rhythm |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNeuropeptide SIFamide
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionQ6IGX9
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown in SIFa-expressing neurons causes normal male sexual activity towards virgin females but also vigorous courtship directed at other males and also leads to female hyper-receptivity with a dramatic decrease in copulation time (PubMed:17126293).
It also causes reduced sleep and shortened sleep bout length (PubMed:24658384).
It also causes reduced sleep and shortened sleep bout length (PubMed:24658384).
PTM/Processing
Features
Showing features for signal, peptide, glycosylation, modified residue, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-26 | |||||
Sequence: MALRFTLTLLLVTILVAAILLGSSEA | ||||||
Peptide | PRO_5006746508 | 27-38 | Neuropeptide SIFamide | |||
Sequence: AYRKPPFNGSIF | ||||||
Glycosylation | 34 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 38 | Phenylalanine amide | ||||
Sequence: F | ||||||
Propeptide | PRO_0000436206 | 42-72 | ||||
Sequence: NSLDYDSAKMSAVCEVAMEACPMWFPQNDSK |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Strongly expressed in two pairs of neurons in the pars intercerebralis (at protein level).
Gene expression databases
Structure
Family & Domains
Sequence similarities
Belongs to the FARP (FMRFamide related peptide) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length72
- Mass (Da)7,901
- Last updated2004-07-05 v1
- ChecksumB832A1D73BE93977
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF376801 EMBL· GenBank· DDBJ | AAO15386.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AE013599 EMBL· GenBank· DDBJ | AFH08249.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT030932 EMBL· GenBank· DDBJ | ABV82314.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BT030951 EMBL· GenBank· DDBJ | ABV82333.1 EMBL· GenBank· DDBJ | mRNA | ||
BT030970 EMBL· GenBank· DDBJ | ABV82352.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BT032699 EMBL· GenBank· DDBJ | ACD81713.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
BK003637 EMBL· GenBank· DDBJ | DAA02335.1 EMBL· GenBank· DDBJ | Genomic DNA |