Q6FIE9 · Q6FIE9_HUMAN
- ProteinTOLLIP protein
- GeneTOLLIP
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids274 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nuclear body | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | protein-containing complex | |
Molecular Function | interleukin-1, type I receptor binding | |
Molecular Function | SUMO binding | |
Molecular Function | ubiquitin binding | |
Molecular Function | ubiquitin conjugating enzyme binding | |
Molecular Function | ubiquitin protein ligase binding | |
Biological Process | autophagy | |
Biological Process | inflammatory response | |
Biological Process | innate immune response | |
Biological Process | interleukin-1-mediated signaling pathway | |
Biological Process | positive regulation of protein sumoylation | |
Biological Process | ubiquitin-dependent protein catabolic process |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ6FIE9
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q6FIE9 | CPSF6 Q16630 | 3 | EBI-10249783, EBI-358410 | |
BINARY | Q6FIE9 | DAB1 O75553 | 3 | EBI-10249783, EBI-7875264 | |
BINARY | Q6FIE9 | DAZAP2 Q15038 | 3 | EBI-10249783, EBI-724310 | |
BINARY | Q6FIE9 | PRR20C P86479 | 3 | EBI-10249783, EBI-10172814 | |
BINARY | Q6FIE9 | RBPMS Q93062 | 3 | EBI-10249783, EBI-740322 | |
BINARY | Q6FIE9 | SIAH1 Q8IUQ4 | 3 | EBI-10249783, EBI-747107 | |
BINARY | Q6FIE9 | TOM1 O60784 | 3 | EBI-10249783, EBI-74634 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 35-152 | C2 | ||||
Sequence: LDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPESLRQGKVEDKWY | ||||||
Domain | 229-272 | CUE | ||||
Sequence: CSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGE |
Sequence similarities
Belongs to the tollip family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length274
- Mass (Da)30,282
- Last updated2005-05-10 v1
- Checksum386E0F284D3837DA
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY730683 EMBL· GenBank· DDBJ | AAX22229.1 EMBL· GenBank· DDBJ | mRNA | ||
AK315592 EMBL· GenBank· DDBJ | BAG37964.1 EMBL· GenBank· DDBJ | mRNA | ||
CR533477 EMBL· GenBank· DDBJ | CAG38508.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471158 EMBL· GenBank· DDBJ | EAX02433.1 EMBL· GenBank· DDBJ | Genomic DNA |