Q6C6R8 · PEX20_YARLI
- ProteinPeroxisome biogenesis protein 20
- GenePEX20
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids417 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Coreceptor required for the peroxisomal import of proteins containing a C-terminal PTS2-type peroxisomal targeting signal, such as 3-oxoacyl-CoA thiolase (PubMed:11606420, PubMed:9679140).
Acts via its interaction with PEX7, promoting association between PEX7 bound to cargo proteins and the PEX13-PEX14 docking complex (PubMed:11606420, PubMed:9679140).
PEX20 along with PEX7 and PTS2-containing cargo proteins are tranlocated into peroxisomes by passing through the PEX13-PEX14 docking complex (PubMed:31042004).
PEX20 coreceptor is then retrotranslocated into the cytosol, leading to release of bound cargo in the peroxisome matrix, and reset for a subsequent peroxisome import cycle (By similarity).
Also mediates peroxisomal import of proteins that do not contain PTS1- or PTS2-type peroxisomal targeting signals, such as acyl-CoA oxidases (Aox) izozymes (PubMed:31042004).
Import of acyl-CoA oxidases (Aox) izozymes is independent of PEX7 (PubMed:31042004).
Acts via its interaction with PEX7, promoting association between PEX7 bound to cargo proteins and the PEX13-PEX14 docking complex (PubMed:11606420, PubMed:9679140).
PEX20 along with PEX7 and PTS2-containing cargo proteins are tranlocated into peroxisomes by passing through the PEX13-PEX14 docking complex (PubMed:31042004).
PEX20 coreceptor is then retrotranslocated into the cytosol, leading to release of bound cargo in the peroxisome matrix, and reset for a subsequent peroxisome import cycle (By similarity).
Also mediates peroxisomal import of proteins that do not contain PTS1- or PTS2-type peroxisomal targeting signals, such as acyl-CoA oxidases (Aox) izozymes (PubMed:31042004).
Import of acyl-CoA oxidases (Aox) izozymes is independent of PEX7 (PubMed:31042004).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | peroxisomal matrix | |
Cellular Component | peroxisomal membrane | |
Molecular Function | peroxisome matrix targeting signal-1 binding | |
Molecular Function | peroxisome matrix targeting signal-2 binding | |
Molecular Function | protein carrier chaperone | |
Biological Process | protein import into peroxisome matrix | |
Biological Process | protein import into peroxisome matrix, docking |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended namePeroxisome biogenesis protein 20
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Fungi > Dikarya > Ascomycota > Saccharomycotina > Saccharomycetes > Saccharomycetales > Dipodascaceae > Yarrowia
Accessions
- Primary accessionQ6C6R8
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Cycles between the cytosol and the peroxisome matrix. Following binding to cargo proteins in the cytosol, recruited to the docking complex, composed of PEX13 and PEX14, leading to translocation into the peroxisome matrix along with cargo proteins. Export and recycling to the cytosol is initiated by binding to the PEX2-PEX10-PEX12 retrotranslocation channel. Cys-4 of PEX20 is then monoubiquitinated by PEX2, promoting its extraction from peroxisomal membrane by the PEX1-PEX6 AAA ATPase complex (By similarity).
Extraction is accompanied by release of bound cargo in the peroxisome matrix (By similarity).
Extraction is accompanied by release of bound cargo in the peroxisome matrix (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 103 | Slight mislocalization of the non-PTS1/non-PTS2 acyl-CoA oxidases (Aox) izozymes. Does not afect import of PTS1-containing proteins. | ||||
Sequence: W → G | ||||||
Mutagenesis | 126 | Slight mislocalization of the non-PTS1/non-PTS2 acyl-CoA oxidases (Aox) izozymes. Does not afect import of PTS1-containing proteins. | ||||
Sequence: W → G | ||||||
Mutagenesis | 280 | Abolished interaction with PEX7; impaired ability to mediate peroxisomal import of PTS2-containing protein 3-oxoacyl-CoA thiolase. Does not affect peroxisomal import of non-PTS1/non-PTS2 acyl-CoA oxidases (Aox) izozymes. | ||||
Sequence: S → F | ||||||
Mutagenesis | 411 | Mislocalization of the non-PTS1/non-PTS2 acyl-CoA oxidases (Aox) izozymes. Does not afect import of PTS1-containing proteins. | ||||
Sequence: W → G |
PTM/Processing
Features
Showing features for chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000456995 | 1-417 | Peroxisome biogenesis protein 20 | |||
Sequence: MASCGPSNALQNLSKHASADRSLQHDRMAPGGAPGAQRQQFRSQTQGGQLNNEFQQFAQAGPAHNSFEQSQMGPHFGQQHFGQPHQPQMGQHAPMAHGQQSDWAQSFSQLNLGPQTGPQHTQQSNWGQDFMRQSPQSHQVQPQMANGVMGSMSGMSSFGPMYSNSQLMNSTYGLQTEHQQTHKTETKSSQDAAFEAAFGAVEESITKTSDKGKEVEKDPMEQTYRYDQADALNRQAEHISDNISREEVDIKTDENGEFASIARQIASSLEEADKSKFEKSTFMNLMRRIGNHEVTLDGDKLVNKEGEDIREEVRDELLREGASQENGFQSEAQQTAPLPVHHEAPPPEQIHPHTETGDKQLEDPMVYIEQEAARRAAESGRTVEEEKLNFYSPFEYAQKLGPQGVAKQSNWEEDYDF | ||||||
Cross-link | 4 | Glycyl cysteine thioester (Cys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: C | ||||||
Cross-link | 15 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K |
Post-translational modification
Monoubiquitinated at Cys-4 by PEX2 during PEX20 passage through the PEX2-PEX10-PEX12 retrotranslocation channel: monoubiquitination acts as a signal for PEX20 extraction and is required for proper export from peroxisomes and recycling (By similarity).
When PEX5 recycling is compromised, polyubiquitinated at Lys-15 by PEX10 during its passage through the retrotranslocation channel, leading to its degradation (By similarity).
When PEX5 recycling is compromised, polyubiquitinated at Lys-15 by PEX10 during its passage through the retrotranslocation channel, leading to its degradation (By similarity).
Keywords
- PTM
PTM databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-18 | Polar residues | ||||
Sequence: MASCGPSNALQNLSKHAS | ||||||
Region | 1-47 | Disordered | ||||
Sequence: MASCGPSNALQNLSKHASADRSLQHDRMAPGGAPGAQRQQFRSQTQG | ||||||
Compositional bias | 65-86 | Polar residues | ||||
Sequence: NSFEQSQMGPHFGQQHFGQPHQ | ||||||
Region | 65-101 | Disordered | ||||
Sequence: NSFEQSQMGPHFGQQHFGQPHQPQMGQHAPMAHGQQS | ||||||
Motif | 103-107 | WxxxF/Y motif 1 | ||||
Sequence: WAQSF | ||||||
Motif | 126-130 | WxxxF/Y motif 2 | ||||
Sequence: WGQDF | ||||||
Region | 321-361 | Disordered | ||||
Sequence: GASQENGFQSEAQQTAPLPVHHEAPPPEQIHPHTETGDKQL | ||||||
Compositional bias | 346-361 | Basic and acidic residues | ||||
Sequence: PPEQIHPHTETGDKQL | ||||||
Motif | 411-415 | WxxxF/Y motif 2 | ||||
Sequence: WEEDY |
Domain
The WxxxF/Y motifs mediate interaction with PEX14, promoting association with the PEX13-PEX14 docking complex.
Sequence similarities
Belongs to the peroxisomal targeting signal receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length417
- Mass (Da)46,580
- Last updated2004-08-16 v1
- ChecksumA18CB8281F92A93E
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-18 | Polar residues | ||||
Sequence: MASCGPSNALQNLSKHAS | ||||||
Compositional bias | 65-86 | Polar residues | ||||
Sequence: NSFEQSQMGPHFGQQHFGQPHQ | ||||||
Sequence conflict | 128-133 | in Ref. 1; AAC23564 | ||||
Sequence: QDFMRQ → EDFMGE | ||||||
Sequence conflict | 140 | in Ref. 1; AAC23564 | ||||
Sequence: V → G | ||||||
Sequence conflict | 193 | in Ref. 1; AAC23564 | ||||
Sequence: A → P | ||||||
Compositional bias | 346-361 | Basic and acidic residues | ||||
Sequence: PPEQIHPHTETGDKQL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF054613 EMBL· GenBank· DDBJ | AAC23564.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
CR382131 EMBL· GenBank· DDBJ | CAG79226.1 EMBL· GenBank· DDBJ | Genomic DNA |