Q6B906 · RK1_GRATL
- ProteinLarge ribosomal subunit protein uL1c
- Generpl1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids235 (go to sequence)
- Protein existenceInferred from homology
- Annotation score2/5
Function
function
Binds directly to 23S rRNA. Might be involved in E site tRNA release (Potential).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | large ribosomal subunit | |
Molecular Function | rRNA binding | |
Molecular Function | structural constituent of ribosome | |
Biological Process | translation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameLarge ribosomal subunit protein uL1c
- Alternative names
Gene names
Encoded on
- Chloroplast
Organism names
- Taxonomic lineageEukaryota > Rhodophyta > Florideophyceae > Rhodymeniophycidae > Gracilariales > Gracilariaceae > Gracilaria > Gracilaria tenuistipitata
Accessions
- Primary accessionQ6B906
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000125788 | 1-235 | Large ribosomal subunit protein uL1c | |||
Sequence: MKKRSRRFSTLLKQIEADKLYSPLDALNLMKNLSNVKFIETAEVHIVLGLDPKYADQQLRTTVMLPKGTGKIMRVAVITQNNKTHEAKSSGADIVGGEDLIDEIKKGRLDFDKLIATPDMMMSIAKLGKILGPKGLMPSPKAGTVTHNLITTIKEFKAGKLEYKIDRSGILHIPFGKLNFNVEDLHINLITLQESIDRNRPQGSKGKYWKSVHINSTMGPSIPLDIQLLRNNYVL |
Interaction
Subunit
Part of the 50S ribosomal subunit.
Structure
Sequence
- Sequence statusComplete
- Length235
- Mass (Da)26,287
- Last updated2004-09-13 v1
- ChecksumC3BDB06598449A07
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY673996 EMBL· GenBank· DDBJ | AAT79629.1 EMBL· GenBank· DDBJ | Genomic DNA |