Q69XM7 · RAN3_ORYSJ
- ProteinGTP-binding nuclear protein Ran-3
- GeneRAN3
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids226 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | GTP binding | |
Molecular Function | GTPase activity | |
Biological Process | protein import into nucleus | |
Biological Process | ribosomal subunit export from nucleus |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameGTP-binding nuclear protein Ran-3
- Short namesOsRan3
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ69XM7
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000347212 | 1-226 | GTP-binding nuclear protein Ran-3 | |||
Sequence: MSRAQALPDPAAVGYPSFKLILVGDGGTGKTTFVKRHITGEFEKRYEPTIGVEVRPLDFHTSRGKVRFCCWDTAGQEKFGGLRDGYYIHGHCAIIMFDVTSRLTYKNVPTWHKDICRVCDNIPIVLCGNKVDMKNRQVKAKMVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLTGDMNLRFVEELALLPADVTIDLIAQQKIETEIAAAAAMPLPDEDEDGLMD |
Proteomic databases
Interaction
Subunit
Found in a nuclear export complex with RanGTP, exportin and pre-miRNA (By similarity).
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length226
- Mass (Da)25,613
- Last updated2004-09-13 v1
- Checksum6A81144F6C778651
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP003612 EMBL· GenBank· DDBJ | BAD32834.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008212 EMBL· GenBank· DDBJ | BAH93613.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014962 EMBL· GenBank· DDBJ | BAS98489.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000143 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |