Q69K07 · PUS4_ORYSJ
- ProteinRNA pseudouridine synthase 4, mitochondrial
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids448 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
Catalytic activity
- a uridine in RNA = a pseudouridine in RNA
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 228 | |||||
Sequence: D |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion | |
Molecular Function | pseudouridine synthase activity | |
Molecular Function | RNA binding | |
Biological Process | enzyme-directed rRNA pseudouridine synthesis |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRNA pseudouridine synthase 4, mitochondrial
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ69K07
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-69 | Mitochondrion | ||||
Sequence: MAALLYLRRRAAAAALAGVAPKPQWLATAARRGALVSGDDGGETGERGKSPWLQLPPFAPLDAAAAARA | ||||||
Chain | PRO_0000368025 | 70-448 | RNA pseudouridine synthase 4, mitochondrial | |||
Sequence: ISRGGGEGGDGEQGATAIKWVRRCCPDLPTSLVQKLFRLRKVKKNVVTAEISSADASAEQHRLRRVSAKDQLMPGDILFLPVNLKESSVAEKTKKFDNRNEINFLRGLEIYKDEAIIVVNKPPGMPVQGGVGIKNSIDVLASMFEENSSEAPRLVHRLDRDCSGILVLGRNQLSTSMLHAIFREKTADALADGTQHVLQRKYVALVIGTPRHPKGLLSAPLAKILLQDGKSERLTIRASSNAASVQDALTEYRVIESCPQGYTWLELFPRTGRKHQRFLEPQLLGITSMDGKRIRSGCLFPCHGQLMRNCSGKGSFPLGLLWVAEASLRSNLSFIYTASKWFFLMSQWLFIGCSLQTLILISQILRSSTLLLHCRCICG |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 84-170 | S4 RNA-binding | ||||
Sequence: ATAIKWVRRCCPDLPTSLVQKLFRLRKVKKNVVTAEISSADASAEQHRLRRVSAKDQLMPGDILFLPVNLKESSVAEKTKKFDNRNE |
Sequence similarities
Belongs to the pseudouridine synthase RluA family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length448
- Mass (Da)49,035
- Last updated2004-09-13 v1
- Checksum85AD88515EB7283F
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 32 | in Ref. 4; AK065573 | ||||
Sequence: R → S | ||||||
Sequence conflict | 79 | in Ref. 4; AK065573 | ||||
Sequence: D → G |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP005909 EMBL· GenBank· DDBJ | BAD34146.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP006061 EMBL· GenBank· DDBJ | BAD36694.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008215 EMBL· GenBank· DDBJ | BAF24470.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014965 EMBL· GenBank· DDBJ | BAT06782.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK065573 EMBL· GenBank· DDBJ | - | mRNA | No translation available. |