Q69J40 · NFYBA_ORYSJ
- ProteinNuclear transcription factor Y subunit B-10
- GeneNFYB10
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids224 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the NF-Y/HAP transcription factor complex.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 27-33 | |||||
Sequence: LPIANVS |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | CCAAT-binding factor complex | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameNuclear transcription factor Y subunit B-10
- Short namesOsNF-YB10
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ69J40
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000437433 | 1-224 | UniProt | Nuclear transcription factor Y subunit B-10 | |||
Sequence: MPDSDNESGGPSNAGEYASAREQDRFLPIANVSRIMKRALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYIDPLKLYLHKFRELEGEKAIGAAGSGGGGAASSGGSGSGSGSHHHQDASRNNGGYGMYGGGGGMIMMMGQPMYGSPPASSAGYAQPPPPHHHHHQMVMGGKGAYGHGGGGGGGPSPSSGYGRQDRL | |||||||
Modified residue (large scale data) | 4 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 8 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Interaction
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MPDSDNESGGPSNAGEYASARE | ||||||
Region | 54-65 | Subunit association domain (SAD) | ||||
Sequence: VQECVSEFISFI | ||||||
Region | 121-152 | Disordered | ||||
Sequence: AGSGGGGAASSGGSGSGSGSHHHQDASRNNGG | ||||||
Compositional bias | 129-147 | Polar residues | ||||
Sequence: ASSGGSGSGSGSHHHQDAS | ||||||
Region | 173-224 | Disordered | ||||
Sequence: SPPASSAGYAQPPPPHHHHHQMVMGGKGAYGHGGGGGGGPSPSSGYGRQDRL |
Sequence similarities
Belongs to the NFYB/HAP3 subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length224
- Mass (Da)23,273
- Last updated2004-09-13 v1
- ChecksumD2E32DC64D138EBF
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 129-147 | Polar residues | ||||
Sequence: ASSGGSGSGSGSHHHQDAS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB288037 EMBL· GenBank· DDBJ | BAF64445.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP005193 EMBL· GenBank· DDBJ | BAD31143.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP006458 EMBL· GenBank· DDBJ | BAD32022.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008213 EMBL· GenBank· DDBJ | BAF22144.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014963 EMBL· GenBank· DDBJ | BAT02572.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK111621 EMBL· GenBank· DDBJ | BAG99337.1 EMBL· GenBank· DDBJ | mRNA | ||
AK112118 EMBL· GenBank· DDBJ | BAG99555.1 EMBL· GenBank· DDBJ | mRNA |