Q69CM7 · MYBPP_RAT
- ProteinMYCBP-associated protein
- GeneMycbpap
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids928 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
May play a role in spermatogenesis (By similarity).
May be involved in synaptic processes
May be involved in synaptic processes
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | clathrin vesicle coat | |
Cellular Component | cytoplasm | |
Cellular Component | endosome | |
Cellular Component | extrinsic component of plasma membrane | |
Cellular Component | plasma membrane | |
Molecular Function | clathrin binding | |
Molecular Function | phospholipid binding | |
Biological Process | cell differentiation | |
Biological Process | chemical synaptic transmission | |
Biological Process | endocytosis | |
Biological Process | spermatogenesis |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameMYCBP-associated protein
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ69CM7
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000302879 | 1-928 | MYCBP-associated protein | |||
Sequence: MKKANDRQSPPKLLEKKRAKAPEQPTPPIQEEPEPVSNVLQGDDILALAIKKEDLTKQHIPQFEETGEKPVVTQKFIIRKLKPKDSCKRVYHLVAHPANPDATTKPLDYSGPRDSFLSSDQILPHQILGSLQDFKRIAVARGNTQLAKLINIQPCLMTLISAKEEPKPKSPKEEKRPPWAPPLQHNFLKNWRRHITLRKKQQEVLSEHLKKPASELLMNSGEGYRKIQEEREAIDRALPTQHDRKAMNCFWSPLEYLGDEKSGLLMTKKKKQRGLVEPITHIRKPFSIQMETGLPVQKDAWYRYTWDRSLFLIYRRKGLQNIMAELDFSQQDIDGLEVVGHGKPFSSVTVEEPLPLEKSQKSSSEDTVFLDSLTNLSDMVPMPILGPSLLFCGKPACWIRGSNPEDKKNIGIGVRLTFETLEGEKTSSELTVVNNGTVAIWYDWRRRPQQDFFQDLKQNRTQRFYFNNREGVILPGETKHFTFFFKSRNAGIFMESWEFGTHPTLLGGAALQITLHAISLTQDIFMDERKLLESKLAAHEAVTIAQSVLQDLLRGVSTPERAPSPVDAYLTEEDLFHYRNPRLHYQHRVVQNLHQLWQQYTEAKASQEEALNLRTPTVPLLFVEKPPDHSRTLASEYPQLQPHQEMDTLKDPKNSLLPQKTGISTKSMQRKSIMEEILVEEGPDRENTRSPRVLENLPPPKWNLCLEDFRQAVMTFPEELQREDALIQLNKAAMELCQEQKPLQSDLLYQMCLQLWRDVIDSLVSQSLWLRSLLGLPEKETVYLDIPDEGQKSPPVTEVKVTSGKLGKEDRRGGAQEKKQLSARDKEEKKGSKTPSKEDRLNSKKQKAKDDKKVVKSTSRDRLLSEDPPADSSATSQEPIDPLVMEKYTQRLYSEVYGLLDNLVIDMMVLADELGSEKNVEEPLRFCT | ||||||
Modified residue | 557 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 558 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 564 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, retina, testis, heart and lung. Not detected in liver, kidney or intestine. In brain, highly abundant in CNS neurons of the hippocampus and cerebellum. Strongly expressed in cochlea and vestibular sensory epithelia. In both the organ of Corti and the vestibular organ, expression is restricted to hair cells.
Developmental stage
After birth, expression in the organ of Corti increases about 10-fold by postnatal day 5 (P5) and remains at constant levels thereafter.
Interaction
Structure
Family & Domains
Features
Showing features for compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-22 | Basic and acidic residues | ||||
Sequence: MKKANDRQSPPKLLEKKRAKAP | ||||||
Region | 1-38 | Disordered | ||||
Sequence: MKKANDRQSPPKLLEKKRAKAPEQPTPPIQEEPEPVSN | ||||||
Region | 164-183 | Disordered | ||||
Sequence: EEPKPKSPKEEKRPPWAPPL | ||||||
Compositional bias | 165-179 | Basic and acidic residues | ||||
Sequence: EPKPKSPKEEKRPPW | ||||||
Region | 786-881 | Disordered | ||||
Sequence: IPDEGQKSPPVTEVKVTSGKLGKEDRRGGAQEKKQLSARDKEEKKGSKTPSKEDRLNSKKQKAKDDKKVVKSTSRDRLLSEDPPADSSATSQEPID | ||||||
Compositional bias | 803-867 | Basic and acidic residues | ||||
Sequence: SGKLGKEDRRGGAQEKKQLSARDKEEKKGSKTPSKEDRLNSKKQKAKDDKKVVKSTSRDRLLSED |
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q69CM7-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsCod106a
- Length928
- Mass (Da)106,345
- Last updated2004-09-13 v1
- Checksum5583ED101F5E0E53
Q69CM7-2
- Name2
- SynonymsCod106b
- Differences from canonical
- 1-14: MKKANDRQSPPKLL → MTPWRSLAPHVTSRGRR
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F1LPD4 | F1LPD4_RAT | Mycbpap | 939 | ||
A0A0G2K1H9 | A0A0G2K1H9_RAT | Mycbpap | 937 | ||
M0RBQ9 | M0RBQ9_RAT | Mycbpap | 964 | ||
A0A8I5XWS6 | A0A8I5XWS6_RAT | Mycbpap | 412 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_052546 | 1-14 | in isoform 2 | |||
Sequence: MKKANDRQSPPKLL → MTPWRSLAPHVTSRGRR | ||||||
Compositional bias | 1-22 | Basic and acidic residues | ||||
Sequence: MKKANDRQSPPKLLEKKRAKAP | ||||||
Compositional bias | 165-179 | Basic and acidic residues | ||||
Sequence: EPKPKSPKEEKRPPW | ||||||
Compositional bias | 803-867 | Basic and acidic residues | ||||
Sequence: SGKLGKEDRRGGAQEKKQLSARDKEEKKGSKTPSKEDRLNSKKQKAKDDKKVVKSTSRDRLLSED |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY353958 EMBL· GenBank· DDBJ | AAR10437.1 EMBL· GenBank· DDBJ | mRNA | ||
AY353959 EMBL· GenBank· DDBJ | AAR10438.1 EMBL· GenBank· DDBJ | mRNA |