Q69383 · REC6_HUMAN
- ProteinEndogenous retrovirus group K member 6 Rec protein
- GeneERVK-6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids105 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Retroviral replication requires the nuclear export and translation of unspliced, singly-spliced and multiply-spliced derivatives of the initial genomic transcript. Rec interacts with a highly structured RNA element (RcRE) present in the viral 3'LTR and recruits the cellular nuclear export machinery. This permits export to the cytoplasm of unspliced genomic or incompletely spliced subgenomic viral transcripts.
Miscellaneous
Despite functional similarity, Rec shares almost no sequence homology with HIV-1 Rev and HTLV-1 Rex.
Two proviruses inserted as tandem repeats in most of individuals tested. Both proviral genomes encode identical Rec proteins.
This Rec protein is encoded by a human specific provirus.
Has a type 2 genome. The HERV-K(HML-2) family contains type 1 and type 2 genomes depending on the absence or presence of 292 nucleotides at the 5'-end of the env gene. Rec proteins are translated from a doubly spliced transcript expressed exclusively by HERV-K(HML-2) type 2 proviral genomes. The first exon comprises the 87 N-terminal amino acids of the HERV-K(HML-2) type 2 envelope protein. The second exon (18 amino acids) is positioned in the 3' part of the proviral genome.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleolus | |
Cellular Component | protein-containing complex | |
Molecular Function | protein homodimerization activity | |
Molecular Function | RNA binding | |
Molecular Function | RNA stem-loop binding | |
Biological Process | mRNA export from nucleus | |
Biological Process | positive regulation of gene expression | |
Biological Process | protein homooligomerization |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameEndogenous retrovirus group K member 6 Rec protein
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ69383
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Shuttles between the nucleus and the cytoplasm. When in the nucleus, resides in the nucleolus.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 4-6 | No loss of function. | ||||
Sequence: SEM → AAA | ||||||
Mutagenesis | 13 | Total loss of function and dominant negative effect; when associated with A-14; A-16; A-18 and A-20. | ||||
Sequence: R → A | ||||||
Mutagenesis | 13-15 | Total loss of function and dominant negative effect. | ||||
Sequence: RRR → AAA | ||||||
Mutagenesis | 14 | Total loss of function and dominant negative effect; when associated with A-13; A-16; A-18 and A-20. | ||||
Sequence: R → A | ||||||
Mutagenesis | 16 | Total loss of function and dominant negative effect; when associated with A-13; A-14; A-18 and A-20. | ||||
Sequence: R → A | ||||||
Mutagenesis | 18 | Total loss of function and dominant negative effect; when associated with A-13; A-14; A-16 and A-20. | ||||
Sequence: R → A | ||||||
Mutagenesis | 19-20 | No loss of function. | ||||
Sequence: NR → AA | ||||||
Mutagenesis | 20 | Total loss of function and dominant negative effect; when associated with A-13; A-14; A-16 and A-18. | ||||
Sequence: R → A | ||||||
Mutagenesis | 30-32 | Total loss of function and dominant negative effect. | ||||
Sequence: MVT → AAA | ||||||
Mutagenesis | 37-39 | Total loss of function and dominant negative effect. | ||||
Sequence: MKL → AAA | ||||||
Mutagenesis | 42-44 | Total loss of function and dominant negative effect. | ||||
Sequence: TKK → AAA | ||||||
Mutagenesis | 48-50 | Total loss of function and dominant negative effect. | ||||
Sequence: PTW → AAA | ||||||
Mutagenesis | 53 | Exclusive nuclear localization; when associated with A-56 and A-59. | ||||
Sequence: L → A | ||||||
Mutagenesis | 53-55 | Total loss of function and dominant negative effect. | ||||
Sequence: LKK → AAA | ||||||
Mutagenesis | 56 | Exclusive nuclear localization; when associated with A-53 and A-59. | ||||
Sequence: L → A | ||||||
Mutagenesis | 59 | Exclusive nuclear localization; when associated with A-53 and A-56. | ||||
Sequence: L → A | ||||||
Mutagenesis | 59-61 | Partial loss of function. | ||||
Sequence: LAT → AAA | ||||||
Mutagenesis | 66-68 | Total loss of function and dominant negative effect. | ||||
Sequence: NTK → AAA | ||||||
Mutagenesis | 76-78 | Total loss of function and dominant negative effect. | ||||
Sequence: MLL → AAA | ||||||
Mutagenesis | 82-84 | Total loss of function and dominant negative effect. | ||||
Sequence: MIV → AAA | ||||||
Mutagenesis | 86-88 | Partial loss of function. | ||||
Sequence: MVS → AAA | ||||||
Mutagenesis | 93-95 | No loss of function. | ||||
Sequence: NSS → AAA |
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000186775 | 1-105 | Endogenous retrovirus group K member 6 Rec protein | |||
Sequence: MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVTQTPESMLLAALMIVSMVSAGVPNSSEETATIENGP |
Proteomic databases
Expression
Tissue specificity
Expressed at higher level in placenta, expressed at lower level in several organs and cell lines.
Interaction
Subunit
Forms homodimers, homotrimers, and homotetramers via a C-terminal domain. Associates with XPO1 and with ZNF145.
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-49 | Disordered | ||||
Sequence: MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPT | ||||||
Compositional bias | 10-24 | Basic residues | ||||
Sequence: APPRRRRHRNRAPLT | ||||||
Motif | 13-20 | Nuclear localization signal | ||||
Sequence: RRRRHRNR | ||||||
Motif | 50-59 | Nuclear export signal | ||||
Sequence: WAQLKKLTQL |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length105
- Mass (Da)11,828
- Last updated1996-11-01 v1
- Checksum9935AF374750102F
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 10-24 | Basic residues | ||||
Sequence: APPRRRRHRNRAPLT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X82271 EMBL· GenBank· DDBJ | CAA57722.1 EMBL· GenBank· DDBJ | mRNA | ||
X82272 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
AF164614 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AF074086 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Y17832 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
Y17834 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AF490464 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |