Q68LC0 · IGF1_RHIRO
- ProteinInsulin-like growth factor I
- GeneIGF1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids153 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. Ca2+-dependent exocytosis of IGF1 is required for sensory perception of smell in the olfactory bulb. Acts as a ligand for IGF1R. Binds to the alpha subunit of IGF1R, leading to the activation of the intrinsic tyrosine kinase activity which autophosphorylates tyrosine residues in the beta subunit thus initiating a cascade of down-stream signaling events leading to activation of the PI3K-AKT/PKB and the Ras-MAPK pathways. Binds to integrins ITGAV:ITGB3 and ITGA6:ITGB4. Its binding to integrins and subsequent ternary complex formation with integrins and IGFR1 are essential for IGF1 signaling. Induces the phosphorylation and activation of IGFR1, MAPK3/ERK1, MAPK1/ERK2 and AKT1 (By similarity).
As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
As part of the MAPK/ERK signaling pathway, acts as a negative regulator of apoptosis in cardiomyocytes via promotion of STUB1/CHIP-mediated ubiquitination and degradation of ICER-type isoforms of CREM (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | alphav-beta3 integrin-IGF-1-IGF1R complex | |
Cellular Component | exocytic vesicle | |
Cellular Component | extracellular space | |
Molecular Function | growth factor activity | |
Molecular Function | hormone activity | |
Molecular Function | insulin-like growth factor receptor binding | |
Biological Process | cell population proliferation | |
Biological Process | insulin-like growth factor receptor signaling pathway | |
Biological Process | negative regulation of apoptotic process | |
Biological Process | negative regulation of release of cytochrome c from mitochondria | |
Biological Process | negative regulation of smooth muscle cell apoptotic process | |
Biological Process | positive regulation of cell population proliferation | |
Biological Process | positive regulation of glucose import | |
Biological Process | positive regulation of glycogen biosynthetic process | |
Biological Process | positive regulation of MAPK cascade | |
Biological Process | regulation of protein phosphorylation |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameInsulin-like growth factor I
- Short namesIGF-I
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Cercopithecidae > Colobinae > Rhinopithecus
Accessions
- Primary accessionQ68LC0
Proteomes
Subcellular Location
PTM/Processing
Features
Showing features for propeptide, signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Propeptide | PRO_0000015676 | ?-48 | ||||
Sequence: MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHLLYLALCLLTFTSSATA | ||||||
Signal | 1-? | |||||
Chain | PRO_0000015677 | 49-118 | Insulin-like growth factor I | |||
Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA | ||||||
Disulfide bond | 54↔96 | |||||
Sequence: CGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECC | ||||||
Disulfide bond | 66↔109 | |||||
Sequence: CGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYC | ||||||
Disulfide bond | 95↔100 | |||||
Sequence: CCFRSC | ||||||
Propeptide | PRO_0000015678 | 119-153 | E peptide | |||
Sequence: RSVRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM |
Keywords
- PTM
Interaction
Subunit
Forms a ternary complex with IGFR1 and ITGAV:ITGB3. Forms a ternary complex with IGFR1 and ITGA6:ITGB4.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 49-77 | B | ||||
Sequence: GPETLCGAELVDALQFVCGDRGFYFNKPT | ||||||
Region | 78-89 | C | ||||
Sequence: GYGSSSRRAPQT | ||||||
Region | 90-110 | A | ||||
Sequence: GIVDECCFRSCDLRRLEMYCA | ||||||
Region | 111-118 | D | ||||
Sequence: PLKPAKSA | ||||||
Region | 120-153 | Disordered | ||||
Sequence: SVRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM | ||||||
Compositional bias | 121-138 | Basic and acidic residues | ||||
Sequence: VRAQRHTDMPKAQKEVHL |
Sequence similarities
Belongs to the insulin family.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length153
- Mass (Da)16,974
- Last updated2004-10-11 v1
- Checksum5B1D232DCA91CC00
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 121-138 | Basic and acidic residues | ||||
Sequence: VRAQRHTDMPKAQKEVHL |
Keywords
- Technical term