Q68CZ6 · HAUS3_HUMAN
- ProteinHAUS augmin-like complex subunit 3
- GeneHAUS3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids603 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centrosome | |
Cellular Component | cytosol | |
Cellular Component | HAUS complex | |
Cellular Component | mitotic spindle | |
Cellular Component | mitotic spindle microtubule | |
Biological Process | cell division | |
Biological Process | centrosome cycle | |
Biological Process | regulation of microtubule nucleation | |
Biological Process | spindle assembly |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHAUS augmin-like complex subunit 3
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ68CZ6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localizes to interphase centrosomes and to mitotic spindle microtubules.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_034912 | 586 | in dbSNP:rs11937432 | |||
Sequence: I → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 798 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylserine | ||||
Sequence: S | ||||||
Chain | PRO_0000301951 | 2-603 | HAUS augmin-like complex subunit 3 | |||
Sequence: SCGNEFVETLKKIGYPKADNLNGEDFDWLFEGVEDESFLKWFCGNVNEQNVLSERELEAFSILQKSGKPILEGAALDEALKTCKTSDLKTPRLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLMMFFRHSNLGQGTNPLVFLSQFSLEKYLSQEEQSTAALTLYTKKQFFQGIHEVVESSNEDNFQLLDIQTPSICDNQEILEERRLEMARLQLAYICAQHQLIHLKASNSSMKSSIKWAEESLHSLTSKAVDKENLDAKISSLTSEIMKLEKEVTQIKDRSLPAVVRENAQLLNMPVVKGDFDLQIAKQDYYTARQELVLNQLIKQKASFELLQLSYEIELRKHRDIYRQLENLVQELSQSNMMLYKQLEMLTDPSVSQQINPRNTIDTKDYSTHRLYQVLEGENKKKELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQEHSFFLSKRNKDVDMLCDTLYQGGNQLLLSDQELTEQFHKVESQLNKLNHLLTDILADVKTKRKTLANNKLHQMEREFYVYFLKDEDYLKDIVENLETQSKIKAVSLED |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Component of the HAUS augmin-like complex. The complex interacts with the gamma-tubulin ring complex and this interaction is required for spindle assembly. Interacts with EML3 (phosphorylated at 'Thr-881') (PubMed:30723163).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q68CZ6 | ANKRD11 X5D778 | 3 | EBI-2558217, EBI-17183751 | |
BINARY | Q68CZ6 | BRME1 Q0VDD7 | 3 | EBI-2558217, EBI-741210 | |
BINARY | Q68CZ6 | CIAO1 O76071 | 3 | EBI-2558217, EBI-725145 | |
BINARY | Q68CZ6 | GNG13 Q9P2W3 | 3 | EBI-2558217, EBI-11427343 | |
BINARY | Q68CZ6 | HAUS6 Q7Z4H7 | 4 | EBI-2558217, EBI-2558196 | |
BINARY | Q68CZ6 | KLF11 O14901 | 3 | EBI-2558217, EBI-948266 | |
BINARY | Q68CZ6 | RCOR3 Q9P2K3-2 | 3 | EBI-2558217, EBI-1504830 | |
BINARY | Q68CZ6 | TXLNA P40222 | 9 | EBI-2558217, EBI-359793 | |
BINARY | Q68CZ6 | TXLNB Q8N3L3 | 3 | EBI-2558217, EBI-6116822 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 93-177 | |||||
Sequence: RLDDKELEKLEDEVQTLLKLKNLKIQRRNKCQLMASVTSHKSLRLNAKEEEATKKLKQSQGILNAMITKISNELQALTDEVTQLM | ||||||
Coiled coil | 305-336 | |||||
Sequence: VDKENLDAKISSLTSEIMKLEKEVTQIKDRSL | ||||||
Coiled coil | 389-426 | |||||
Sequence: LSYEIELRKHRDIYRQLENLVQELSQSNMMLYKQLEML | ||||||
Coiled coil | 458-495 | |||||
Sequence: ENKKKELFLTHGNLEEVAEKLKQNISLVQDQLAVSAQE |
Sequence similarities
Belongs to the HAUS3 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q68CZ6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length603
- Mass (Da)69,650
- Last updated2004-10-11 v1
- ChecksumC65B80CC58F326E9
Q68CZ6-2
- Name2
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D6R993 | D6R993_HUMAN | HAUS3 | 33 | ||
A0A1D5RMS3 | A0A1D5RMS3_HUMAN | HAUS3 | 10 |
Sequence caution
Features
Showing features for alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF040964 EMBL· GenBank· DDBJ | AAB97010.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK293948 EMBL· GenBank· DDBJ | BAG57325.1 EMBL· GenBank· DDBJ | mRNA | ||
CR749640 EMBL· GenBank· DDBJ | CAH18434.1 EMBL· GenBank· DDBJ | mRNA | ||
AL158068 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471131 EMBL· GenBank· DDBJ | EAW82537.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC003648 EMBL· GenBank· DDBJ | AAH03648.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BC025356 EMBL· GenBank· DDBJ | AAH25356.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |