Q67VC8 · DPOLL_ORYSJ
- ProteinDNA polymerase lambda
- GenePOLL
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids549 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Repair polymerase involved in base excision repair (BER) and responsible for repair of lesions that give rise to abasic (AP) sites in DNA. Has both DNA polymerase and terminal transferase activities. Has a 5'-deoxyribose-5-phosphate lyase (dRP lyase) activity.
Catalytic activity
- a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)
Cofactor
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 280 | |||||
Sequence: H | ||||||
Binding site | 356 | dCTP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 387-390 | dCTP (UniProtKB | ChEBI) | ||||
Sequence: SYRR | ||||||
Binding site | 396-399 | dCTP (UniProtKB | ChEBI) | ||||
Sequence: GDMD | ||||||
Binding site | 397 | Mn2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 399 | Mn2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 464 | Mn2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 487 | dCTP (UniProtKB | ChEBI) | ||||
Sequence: N |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | 5'-deoxyribose-5-phosphate lyase activity | |
Molecular Function | DNA binding | |
Molecular Function | DNA-directed DNA polymerase activity | |
Molecular Function | manganese ion binding | |
Biological Process | base-excision repair, AP site formation via deaminated base removal | |
Biological Process | DNA replication | |
Biological Process | double-strand break repair via nonhomologous end joining | |
Biological Process | nucleotide-excision repair | |
Biological Process | response to UV-B |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA polymerase lambda
- EC number
- Short namesOsPolL ; Pol Lambda
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ67VC8
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 397 | Loss of polymerase activity; when associated with A-399. | ||||
Sequence: D → A | ||||||
Mutagenesis | 399 | Loss of polymerase activity; when associated with A-397. | ||||
Sequence: D → A |
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000438213 | 1-549 | UniProt | DNA polymerase lambda | |||
Sequence: MAPKRKPPARAAAAKLDPDGMFRGVSAFVVPHAVQSRRLEVWKQRLAQMGGRVQEKLAAKGGGGAVTHVLAADAKALLRELDAAWLHRFRGSVVSFEWLEECLKSGERLPEHKFAINYEEEFKPKKEGGAAGSGVLQSAKRSKISSDGPENRKETAGGNRESRDAIAHPNEDSDVVKGPSTCTSSQSASGDSKETIASQNAFKAEEASSGESSTYAPPDLNRNITEIFGKLINIYRALGDDRRSFSYYKAIPVIEKLPFKIESADQVKDLPAIGKSLKDHINEIVNTGKLSKLEHFENDEKVRTVSLFGEVWGVGPATALKLYDKGHRTLDDLQKDDSLTSAQRIGLKFFDDIKQRIPRHEVSEMEKLLQEVGTDILPGVIIVCGGSYRRGKSSCGDMDIIITHPDGESHVGFLPKFVQRLKGINFLREDLIFSIHSIEGTDCGVDTYFGLCTYPGRELRHRIDLKVYPRNRHAFGLLAWTGNDVLNRRLRILADSKGYILDDTGLYLATPGSGGKRGGRSDAIINCDTEKDVFDTLGFPWLEPHERNL | |||||||
Modified residue (large scale data) | 173 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Expression
Tissue specificity
Expressed in proliferating tissues. Expressed in roots, root apex, young leaves, shoot apical meristem (SAM), flag leaves and panicles.
Induction
By UV treatment and methyl methanesulfonate (MMS).
Interaction
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 17-116 | BRCT | ||||
Sequence: DPDGMFRGVSAFVVPHAVQSRRLEVWKQRLAQMGGRVQEKLAAKGGGGAVTHVLAADAKALLRELDAAWLHRFRGSVVSFEWLEECLKSGERLPEHKFAI | ||||||
Region | 126-197 | Disordered | ||||
Sequence: KEGGAAGSGVLQSAKRSKISSDGPENRKETAGGNRESRDAIAHPNEDSDVVKGPSTCTSSQSASGDSKETIA | ||||||
Compositional bias | 145-171 | Basic and acidic residues | ||||
Sequence: SSDGPENRKETAGGNRESRDAIAHPNE | ||||||
Compositional bias | 176-197 | Polar residues | ||||
Sequence: VKGPSTCTSSQSASGDSKETIA | ||||||
Region | 233-247 | DNA-binding | ||||
Sequence: NIYRALGDDRRSFSY | ||||||
Region | 315-318 | DNA-binding | ||||
Sequence: GPAT | ||||||
Region | 390-399 | Involved in primer binding | ||||
Sequence: RGKSSCGDMD | ||||||
Region | 438-479 | DNA-binding | ||||
Sequence: IEGTDCGVDTYFGLCTYPGRELRHRIDLKVYPRNRHAFGLLA |
Sequence similarities
Belongs to the DNA polymerase type-X family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length549
- Mass (Da)60,628
- Last updated2004-10-11 v1
- ChecksumCBDEBE99CA6BEF46
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 11 | in Ref. 1; BAD18976 | ||||
Sequence: A → AAAA | ||||||
Compositional bias | 145-171 | Basic and acidic residues | ||||
Sequence: SSDGPENRKETAGGNRESRDAIAHPNE | ||||||
Compositional bias | 176-197 | Polar residues | ||||
Sequence: VKGPSTCTSSQSASGDSKETIA | ||||||
Sequence conflict | 423 | in Ref. 1; BAD18976 | ||||
Sequence: G → D |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB099525 EMBL· GenBank· DDBJ | BAD18976.1 EMBL· GenBank· DDBJ | mRNA | ||
AP004995 EMBL· GenBank· DDBJ | BAD37891.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008212 EMBL· GenBank· DDBJ | BAF19161.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
AP014962 EMBL· GenBank· DDBJ | BAS96965.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. |