Q66K41 · Z385C_HUMAN
- ProteinZinc finger protein 385C
- GeneZNF385C
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids422 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | nucleic acid binding | |
Molecular Function | zinc ion binding |
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameZinc finger protein 385C
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ66K41
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000319941 | 1-422 | Zinc finger protein 385C | |||
Sequence: MLLGPASGAPSPLLASLPLPTRPLQPPLDFKHLLAFHFNGAAPLSLFPNFSTMDPVQKAVISHTFGVPSPLKKKLFISCNICHLRFNSANQAEAHYKGHKHARKLKAVEAAKSKQRPHTQAQDGAVVSPIPTLASGAPGEPQSKVPAAPPLGPPLQPPPTPDPTCREPAHSELLDAASSSSSSSCPPCSPEPGREAPGPEPAAAAVGSSMSGEGRSEKGHLYCPTCKVTVNSASQLQAHNTGAKHRWMMEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPSPAFHCALCQLQVNSETQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQKHAALAVSILKSKLALQKQLTKTLAARFLPSPLPTAATAICALPGPLALRPAPTAATTLFPAPILGPALFRTPAGAVRPATGPIVLAPY |
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q66K41 | BOLL Q8N9W6 | 4 | EBI-8651919, EBI-998198 | |
BINARY | Q66K41 | HNRNPK P61978 | 7 | EBI-8651919, EBI-304185 | |
BINARY | Q66K41 | PSMA3 P25788 | 4 | EBI-8651919, EBI-348380 | |
BINARY | Q66K41 | RBMY1J Q15415 | 3 | EBI-8651919, EBI-8642021 | |
BINARY | Q66K41 | RBPMS Q93062 | 3 | EBI-8651919, EBI-740322 | |
BINARY | Q66K41 | THAP1 Q9NVV9 | 4 | EBI-8651919, EBI-741515 | |
BINARY | Q66K41-2 | BOLL Q8N9W6-4 | 3 | EBI-12055653, EBI-11983447 | |
BINARY | Q66K41-2 | PRR20D P86480 | 3 | EBI-12055653, EBI-12754095 | |
BINARY | Q66K41-2 | RBM47 A0AV96 | 3 | EBI-12055653, EBI-2823850 | |
BINARY | Q66K41-2 | RBPMS2 Q6ZRY4 | 3 | EBI-12055653, EBI-11987469 | |
BINARY | Q66K41-2 | SRSF11 Q05519-2 | 3 | EBI-12055653, EBI-11975029 | |
BINARY | Q66K41-2 | THAP1 Q9NVV9 | 3 | EBI-12055653, EBI-741515 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for zinc finger, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Zinc finger | 77-107 | Matrin-type 1 | ||||
Sequence: ISCNICHLRFNSANQAEAHYKGHKHARKLKA | ||||||
Region | 107-218 | Disordered | ||||
Sequence: AVEAAKSKQRPHTQAQDGAVVSPIPTLASGAPGEPQSKVPAAPPLGPPLQPPPTPDPTCREPAHSELLDAASSSSSSSCPPCSPEPGREAPGPEPAAAAVGSSMSGEGRSEK | ||||||
Compositional bias | 143-165 | Pro residues | ||||
Sequence: SKVPAAPPLGPPLQPPPTPDPTC | ||||||
Compositional bias | 174-188 | Polar residues | ||||
Sequence: LDAASSSSSSSCPPC | ||||||
Zinc finger | 225-259 | Matrin-type 2 | ||||
Sequence: TCKVTVNSASQLQAHNTGAKHRWMMEGQRGAPRRS | ||||||
Region | 249-287 | Disordered | ||||
Sequence: MEGQRGAPRRSRGRPVSRGGAGHKAKRVTGGRGGRQGPS | ||||||
Zinc finger | 290-320 | Matrin-type 3 | ||||
Sequence: FHCALCQLQVNSETQLKQHMSSRRHKDRLAG | ||||||
Region | 303-333 | Disordered | ||||
Sequence: TQLKQHMSSRRHKDRLAGKTPKPSSQHSKLQ |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q66K41-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length422
- Mass (Da)44,149
- Last updated2020-06-17 v4
- Checksum716E7C8FFA0F6219
Q66K41-2
- Name2
- Differences from canonical
- 1-248: Missing
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
C9J6X6 | C9J6X6_HUMAN | ZNF385C | 499 | ||
A0A3B3IS60 | A0A3B3IS60_HUMAN | ZNF385C | 175 | ||
A0A3B3ITE2 | A0A3B3ITE2_HUMAN | ZNF385C | 398 | ||
A0A8I5KWL9 | A0A8I5KWL9_HUMAN | ZNF385C | 503 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_031546 | 1-248 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 143-165 | Pro residues | ||||
Sequence: SKVPAAPPLGPPLQPPPTPDPTC | ||||||
Compositional bias | 174-188 | Polar residues | ||||
Sequence: LDAASSSSSSSCPPC |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC105024 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC080613 EMBL· GenBank· DDBJ | AAH80613.1 EMBL· GenBank· DDBJ | mRNA |