Q66IE4 · T237B_DANRE
- ProteinTransmembrane protein 237B
- Genetmem237b
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids413 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Component of the transition zone in primary cilia. Required for ciliogenesis.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | ciliary transition zone | |
Cellular Component | membrane | |
Biological Process | cilium assembly | |
Biological Process | convergent extension involved in gastrulation | |
Biological Process | regulation of Wnt signaling pathway |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameTransmembrane protein 237B
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ66IE4
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Multi-pass membrane protein
Note: Localizes to the transition zone.
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 233-253 | Helical | ||||
Sequence: VIGLFSHGFLAGYAVWNIIVV | ||||||
Transmembrane | 274-294 | Helical | ||||
Sequence: LAYPAQSLLYLLLALSTVSAF | ||||||
Transmembrane | 312-332 | Helical | ||||
Sequence: LSPVALASVFYFSALVLSLSQ | ||||||
Transmembrane | 360-380 | Helical | ||||
Sequence: ILYPWITVNLVVSLLVGLAWI |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Fishes lacking both tmem237a and tmem237b display defects in midsomitic embryos, including shortening of the anterior-posterior axis and small anterior structures, kinking of the notochord, and broadening and thinning of the somite.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000415832 | 1-413 | Transmembrane protein 237B | |||
Sequence: MDPEAKVSSSRRRDLPPIPQGQRRTPRALPSMPSQDTAEEMPAPKSRKKKAKRDAESVDEPDDGGMEMGGLASRRQSECPEPLTPEPLDNPPQRRKKKKKAQAIDAEGDQTDLVSNGDTLDQNTDEEVTRKPKKRKVKPKVTETQSNNELDVEDDDVITDPQSPIPQHSLFSAPQGPSQPVGKVFVEKSRRFQAADRVEQWKPSGPIEQSIMDIRSMWTTRDVSMRVHSGFRVIGLFSHGFLAGYAVWNIIVVYVLAGDQMSSLSNLLQQFHTLAYPAQSLLYLLLALSTVSAFDRVNLAKAPAAMRSLLRLSPVALASVFYFSALVLSLSQQMTSDRINLYKYSSYNTTLWPPGSESSILYPWITVNLVVSLLVGLAWILMSTSPDIDNTEAFLMSMEMEYPNSEEKGNVTA |
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-162 | Disordered | ||||
Sequence: MDPEAKVSSSRRRDLPPIPQGQRRTPRALPSMPSQDTAEEMPAPKSRKKKAKRDAESVDEPDDGGMEMGGLASRRQSECPEPLTPEPLDNPPQRRKKKKKAQAIDAEGDQTDLVSNGDTLDQNTDEEVTRKPKKRKVKPKVTETQSNNELDVEDDDVITDPQ | ||||||
Compositional bias | 41-59 | Basic and acidic residues | ||||
Sequence: MPAPKSRKKKAKRDAESVD |
Sequence similarities
Belongs to the TMEM237 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length413
- Mass (Da)45,969
- Last updated2004-10-11 v1
- ChecksumE68806A1760B24AD
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M3AT44 | A0A8M3AT44_DANRE | tmem237b | 414 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 41-59 | Basic and acidic residues | ||||
Sequence: MPAPKSRKKKAKRDAESVD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CU570787 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC081384 EMBL· GenBank· DDBJ | AAH81384.1 EMBL· GenBank· DDBJ | mRNA |