Q66IA6 · LYPD6_DANRE
- ProteinLy6/PLAUR domain-containing protein 6
- Genelypd6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids174 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as an important regulator of embryogenesis through its enhancement of Wnt/beta-catenin signaling. Positively regulates Wnt/beta-catenin signaling by ensuring phosphorylation of lrp6 specifically in plasma membrane rafts and its subsequent internalization into signaling-competent vesicles. Essential for the wnt8-mediated patterning of the mesoderm and neuroectoderm during gastrulation (PubMed:23987510).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane raft | |
Cellular Component | plasma membrane | |
Cellular Component | side of membrane | |
Molecular Function | acetylcholine receptor inhibitor activity | |
Biological Process | positive regulation of canonical Wnt signaling pathway | |
Biological Process | regulation of canonical Wnt signaling pathway | |
Biological Process | regulation of Wnt signaling pathway | |
Biological Process | Spemann organizer formation |
Names & Taxonomy
Protein names
- Recommended nameLy6/PLAUR domain-containing protein 6
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionQ66IA6
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-22 | |||||
Sequence: MEPWPLMAWGLMLTAITGWIKA | ||||||
Chain | PRO_5008970952 | 23-149 | Ly6/PLAUR domain-containing protein 6 | |||
Sequence: VQSRDFTEKDIIFLHPSTTPYPGGFKCFTCEDAPDNYECNRWAPDLYCPRESRYCYTHHKMSWDGNTVSVTKRCVPLEDCLQTGCSDIDHEGNRVCTACCEGNICNLPLPRNETDAIFSTTSPINRS | ||||||
Disulfide bond | 49↔77 | |||||
Sequence: CFTCEDAPDNYECNRWAPDLYCPRESRYC | ||||||
Disulfide bond | 52↔61 | |||||
Sequence: CEDAPDNYEC | ||||||
Disulfide bond | 70↔96 | |||||
Sequence: CPRESRYCYTHHKMSWDGNTVSVTKRC | ||||||
Disulfide bond | 102↔121 | |||||
Sequence: CLQTGCSDIDHEGNRVCTAC | ||||||
Disulfide bond | 107↔118 | |||||
Sequence: CSDIDHEGNRVC | ||||||
Disulfide bond | 122↔127 | |||||
Sequence: CEGNIC | ||||||
Glycosylation | 134 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 147 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Lipidation | 149 | GPI-anchor amidated serine | ||||
Sequence: S | ||||||
Propeptide | PRO_0000457044 | 150-174 | Removed in mature form | |||
Sequence: AQSTQTLPLLLLSVSITSLMLHSIN |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
Initially detected in mesendodermal cells at late blastula stages. During gastrulation, expressed in a broad marginal domain and becomes excluded from the ventral animal pole at late gastrula stages. During segmentation, initially exclusively detected in the somitic mesoderm but later also in the otic and optic vesicles. During organogenesis, expression is largely down-regulated in the somites but maintained in the otic vesicles and the retina.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 47-141 | UPAR/Ly6 | ||||
Sequence: FKCFTCEDAPDNYECNRWAPDLYCPRESRYCYTHHKMSWDGNTVSVTKRCVPLEDCLQTGCSDIDHEGNRVCTACCEGNICNLPLPRNETDAIFS |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length174
- Mass (Da)19,585
- Last updated2004-10-11 v1
- Checksum15D60A11C09D57C3
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M9Q4J3 | A0A8M9Q4J3_DANRE | lypd6 | 174 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
CR394542 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC081426 EMBL· GenBank· DDBJ | AAH81426.1 EMBL· GenBank· DDBJ | mRNA |