Q652Q0 · GL92_ORYSJ
- ProteinPutative germin-like protein 9-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids214 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Molecular Function | manganese ion binding |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended namePutative germin-like protein 9-2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ652Q0
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MALSYYSLLLLLLAVWAPALTLVMA | ||||||
Chain | PRO_0000365528 | 26-214 | Putative germin-like protein 9-2 | |||
Sequence: GDPDILTDYVIPANGNPMNITGDFFTFTGFRKVFNTSSAPEPNSFTVTKATMAEFPALNGQSVSYATLVFPPSTVNPPHTHPRSAELLLVVDGALSVGFIDTTNKLYTQDLAAGDMFVFPKGMVHFQFNSGNQPAMALSAFGSAAPGVVPVPVTVFGTGIDDAVLAKSFKTDVPTILKLKANLTPPNKS | ||||||
Glycosylation | 44 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 60 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
Interaction
Subunit
Oligomer (believed to be a pentamer but probably hexamer).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 56-202 | Cupin type-1 | ||||
Sequence: RKVFNTSSAPEPNSFTVTKATMAEFPALNGQSVSYATLVFPPSTVNPPHTHPRSAELLLVVDGALSVGFIDTTNKLYTQDLAAGDMFVFPKGMVHFQFNSGNQPAMALSAFGSAAPGVVPVPVTVFGTGIDDAVLAKSFKTDVPTIL |
Sequence similarities
Belongs to the germin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length214
- Mass (Da)22,674
- Last updated2004-10-25 v1
- Checksum7CBFCC27A82412D5
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP005546 EMBL· GenBank· DDBJ | BAD46217.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014965 EMBL· GenBank· DDBJ | BAT09491.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000146 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |