Q63ZY6 · NSN5C_HUMAN
- ProteinPutative methyltransferase NSUN5C
- GeneNSUN5P2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids315 (go to sequence)
- Protein existenceUncertain
- Annotation score5/5
Function
function
May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 50-56 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: VPPQAIK | ||||||
Binding site | 74 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 79 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 121 | S-adenosyl-L-methionine (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Active site | 175 | Nucleophile | ||||
Sequence: C |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleolus | |
Molecular Function | RNA binding | |
Molecular Function | RNA methyltransferase activity | |
Biological Process | rRNA base methylation |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePutative methyltransferase NSUN5C
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ63ZY6
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Disease & Variants
Involvement in disease
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_029476 | 47 | in dbSNP:rs400282 | |||
Sequence: W → S | ||||||
Natural variant | VAR_029477 | 90 | in dbSNP:rs395127 | |||
Sequence: A → V | ||||||
Natural variant | VAR_029478 | 272 | in dbSNP:rs17145838 | |||
Sequence: C → R | ||||||
Natural variant | VAR_029479 | 303 | ||||
Sequence: K → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 4 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000261672 | 1-315 | UniProt | Putative methyltransferase NSUN5C | |||
Sequence: MPELLVFPAQTDLHEHPLYRAGHLILQDRASCLPAMLLDPRQAPMSWMPVPPQAIKTSHLAALLKNQGKIFAFDLDARRLASMATLLAWAGVSCCELAEEDFLAVSPLDPRYREVHYVLLDPSCSGSGMPSRQLEEPGAGTPSPVRLHALAGFQQRALCHALTFPSLQRLVYSMCSLCQEENEDMVQDALQQNPGAFRLAPALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAKSCSRCLHTALHIAEAPGSLLPGGKGRCLSSPWKTLGPHRRQQFAF | |||||||
Modified residue (large scale data) | 141 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 143 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 253 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 258 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 260 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Ubiquitous.
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 245-269 | Disordered | ||||
Sequence: TSASQAKASAPERTPSPAPKRKKRA |
Sequence similarities
Belongs to the class I-like SAM-binding methyltransferase superfamily. RsmB/NOP family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing.
Q63ZY6-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length315
- Mass (Da)34,347
- Last updated2006-11-28 v2
- Checksum3DE31F9DC38A5DF4
Q63ZY6-2
- Name2
Q63ZY6-4
- Name3
Q63ZY6-5
- Name4
- Differences from canonical
- 246-315: Missing
Q63ZY6-6
- Name5
- Differences from canonical
- 145-168: Missing
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_021759 | 1-128 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 2 | in Ref. 5; AAH82753 | ||||
Sequence: P → L | ||||||
Sequence conflict | 42 | in Ref. 1; AAL16068 and 3; BAB13875 | ||||
Sequence: Q → R | ||||||
Sequence conflict | 128 | in Ref. 4; CAH56289 | ||||
Sequence: G → GG | ||||||
Alternative sequence | VSP_021761 | 129-135 | in isoform 2 | |||
Sequence: MPSRQLE → EMVRRRG | ||||||
Alternative sequence | VSP_021762 | 136-315 | in isoform 2 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_021763 | 145-168 | in isoform 5 | |||
Sequence: Missing | ||||||
Sequence conflict | 195 | in Ref. 1; AAL16068 and 3; BAB13875 | ||||
Sequence: G → D | ||||||
Alternative sequence | VSP_021765 | 246-315 | in isoform 3 and isoform 4 | |||
Sequence: Missing | ||||||
Sequence conflict | 281 | in Ref. 1; AAL16068 and 3; BAB13875 | ||||
Sequence: H → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF420250 EMBL· GenBank· DDBJ | AAL16068.1 EMBL· GenBank· DDBJ | mRNA | ||
AF416611 EMBL· GenBank· DDBJ | AAM62319.1 EMBL· GenBank· DDBJ | mRNA | ||
AK021688 EMBL· GenBank· DDBJ | BAB13875.1 EMBL· GenBank· DDBJ | mRNA | ||
AK292107 EMBL· GenBank· DDBJ | BAF84796.1 EMBL· GenBank· DDBJ | mRNA | ||
AL833016 EMBL· GenBank· DDBJ | CAH56289.1 EMBL· GenBank· DDBJ | mRNA | Different termination. | |
BC056405 EMBL· GenBank· DDBJ | AAH56405.1 EMBL· GenBank· DDBJ | mRNA | ||
BC082753 EMBL· GenBank· DDBJ | AAH82753.2 EMBL· GenBank· DDBJ | mRNA | ||
BC093976 EMBL· GenBank· DDBJ | AAH93976.1 EMBL· GenBank· DDBJ | mRNA | ||
BC101515 EMBL· GenBank· DDBJ | AAI01516.1 EMBL· GenBank· DDBJ | mRNA | ||
BC106049 EMBL· GenBank· DDBJ | AAI06050.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |