Q62809 · NOGG_RAT

Function

function

Essential for cartilage morphogenesis and joint formation. Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite (By similarity).
Inhibits chondrocyte differentiation through its interaction with GDF5 and, probably, GDF6 (By similarity).

GO annotations

all annotationsall molecular functionvirus receptor activitydna bindingrna bindingcytoskeletal motor activitycatalytic activitygtpase activitystructural molecule activitytransporter activitycytoskeletal protein bindinglipid bindingcyclase activityantioxidant activityoxidoreductase activitytransferase activityhydrolase activitylyase activityisomerase activityligase activityprotein tag activitycargo receptor activityhistone bindingprotein folding chaperonetranslation regulator activitynutrient reservoir activityreceptor ligand activitymolecular transducer activitymolecular adaptor activitytoxin activitycell adhesion mediator activitymolecular function regulator activityvirus coreceptor activitycatalytic activity, acting on a proteincatalytic activity, acting on dnacatalytic activity, acting on rnamolecular carrier activitytranscription regulator activitygeneral transcription initiation factor activitymolecular sensor activitymolecular sequestering activityatp-dependent activityother molecular functionall biological processmitotic cell cyclecytokinesiscytoplasmic translationimmune system processmuscle system processcirculatory system processrenal system processrespiratory system processcarbohydrate metabolic processgeneration of precursor metabolites and energydna replicationdna repairdna recombinationchromatin organizationdna-templated transcriptionregulation of dna-templated transcriptiontrna metabolic processprotein foldingprotein glycosylationamino acid metabolic processmodified amino acid metabolic processlipid metabolic processvitamin metabolic processsulfur compound metabolic processintracellular protein transportnucleocytoplasmic transportautophagyinflammatory responsemitochondrion organizationcytoskeleton organizationmicrotubule-based movementperoxisome organizationlysosome organizationchromosome segregationcell adhesionestablishment or maintenance of cell polarityprogrammed cell deathphotosynthesismrna metabolic processsnrna metabolic processvesicle-mediated transportreproductive processdigestive system processsignalingcell differentiationprotein catabolic processextracellular matrix organizationregulatory ncrna-mediated gene silencingtelomere organizationcell junction organizationwound healingribosome biogenesiscilium organizationanatomical structure developmentcell motilitynervous system processendocrine processprotein maturationtransmembrane transportnucleobase-containing small molecule metabolic processhepaticobiliary system processmembrane organizationprotein-containing complex assemblycell wall organization or biogenesisnitrogen cycle metabolic processprotein localization to plasma membranedefense response to other organismdetoxificationmeiotic nuclear divisionmitotic nuclear divisionmitochondrial gene expressioncarbohydrate derivative metabolic processother biological processall cellular componentnuclear chromosomeextracellular regionextracellular spacecell wallnucleusnuclear envelopenucleoplasmchromosomenucleolusmitochondrionlysosomeendosomevacuoleperoxisomeendoplasmic reticulumgolgi apparatuslipid dropletmicrotubule organizing centercytosolribosomecytoskeletonplasma membraneciliumplastidthylakoidexternal encapsulating structureextracellular matrixcytoplasmic vesicleorganelleother cellular component
Cell color indicative of number of GO terms
AspectTerm
Cellular Componentaxon
Cellular Componentextracellular space
Cellular Componentpresynapse
Cellular Componentprotein-containing complex
Molecular Functioncytokine binding
Molecular Functionprotein homodimerization activity
Molecular Functionprotein-containing complex binding
Biological Processanatomical structure formation involved in morphogenesis
Biological Processatrial cardiac muscle tissue morphogenesis
Biological Processaxial mesoderm development
Biological Processaxon guidance
Biological ProcessBMP signaling pathway
Biological Processbrain development
Biological Processcartilage development
Biological Processcell differentiation in hindbrain
Biological Processcell population proliferation
Biological Processcellular response to BMP stimulus
Biological Processcellular response to hypoxia
Biological Processcentral nervous system development
Biological Processcranial skeletal system development
Biological Processdorsal/ventral pattern formation
Biological Processembryonic digit morphogenesis
Biological Processembryonic skeletal joint morphogenesis
Biological Processembryonic skeletal system development
Biological Processendocardial cushion formation
Biological Processendoderm development
Biological Processendoderm formation
Biological Processepithelial cell proliferation
Biological Processepithelial to mesenchymal transition
Biological Processexploration behavior
Biological Processface morphogenesis
Biological Processfibroblast growth factor receptor signaling pathway
Biological Processforebrain development
Biological Processheart trabecula morphogenesis
Biological Processhippocampus development
Biological Processin utero embryonic development
Biological Processlimb development
Biological Processlong-term synaptic potentiation
Biological Processlung morphogenesis
Biological Processmembranous septum morphogenesis
Biological Processmemory
Biological Processmesenchymal cell differentiation
Biological Processmesoderm formation
Biological Processmiddle ear morphogenesis
Biological Processmotor neuron axon guidance
Biological Processnegative regulation of apoptotic signaling pathway
Biological Processnegative regulation of astrocyte differentiation
Biological Processnegative regulation of BMP signaling pathway
Biological Processnegative regulation of canonical Wnt signaling pathway
Biological Processnegative regulation of cardiac epithelial to mesenchymal transition
Biological Processnegative regulation of cardiac muscle cell proliferation
Biological Processnegative regulation of cartilage development
Biological Processnegative regulation of cell migration
Biological Processnegative regulation of gene expression
Biological Processnegative regulation of osteoblast differentiation
Biological Processnegative regulation of SMAD protein signal transduction
Biological Processnegative regulation of transcription by RNA polymerase II
Biological Processneural plate anterior/posterior regionalization
Biological Processneural plate morphogenesis
Biological Processneural tube closure
Biological Processneural tube development
Biological Processnodal signaling pathway
Biological Processnotochord morphogenesis
Biological Processossification
Biological Processosteoblast differentiation
Biological Processoutflow tract morphogenesis
Biological Processpattern specification process
Biological Processpharyngeal arch artery morphogenesis
Biological Processpituitary gland development
Biological Processpositive regulation of branching involved in ureteric bud morphogenesis
Biological Processpositive regulation of cell population proliferation
Biological Processpositive regulation of epithelial cell proliferation
Biological Processpositive regulation of gene expression
Biological Processpositive regulation of glomerulus development
Biological Processpositive regulation of oligodendrocyte progenitor proliferation
Biological Processpositive regulation of transcription by RNA polymerase II
Biological Processpresynaptic modulation of chemical synaptic transmission
Biological Processprostatic bud formation
Biological Processregulation of BMP signaling pathway
Biological Processregulation of fibroblast growth factor receptor signaling pathway
Biological Processregulation of neuronal synaptic plasticity
Biological Processshort-term synaptic potentiation
Biological Processskeletal system development
Biological Processsmoothened signaling pathway
Biological Processsomatic stem cell population maintenance
Biological Processsomite development
Biological Processspinal cord development
Biological Processstem cell differentiation
Biological Processureteric bud development
Biological Processureteric bud formation
Biological Processurogenital system development
Biological Processventricular compact myocardium morphogenesis
Biological Processventricular septum morphogenesis
Biological Processvisual learning
Biological Processwound healing

Keywords

Names & Taxonomy

Protein names

  • Recommended name
    Noggin

Gene names

    • Name
      Nog

Organism names

  • Taxonomic identifier
  • Strain
    • Sprague-Dawley
  • Taxonomic lineage
    Eukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus

Accessions

  • Primary accession
    Q62809

Proteomes

Organism-specific databases

Subcellular Location

PTM/Processing

Features

Showing features for signal, chain, disulfide bond.

TypeIDPosition(s)Description
Signal1-4
ChainPRO_00000198155-144Noggin
Disulfide bond67↔104
Disulfide bond90↔140
Disulfide bond96↔142
Disulfide bond119↔127

Keywords

Proteomic databases

PTM databases

Expression

Tissue specificity

Prominently expressed in the CNS. High levels found in mitral and tufted cells in the olfactory bulb, piriform cortex of the brain and Purkinje cells in the cerebellum. Low level expression seen in the lung, skeletal muscle and skin.

Developmental stage

First detected at embryonic day 9 and in the brain, expression increases steadily from embryonic day 17 to postnatal day 19.

Interaction

Subunit

Homodimer. Interacts with GDF5; inhibits chondrocyte differentiation.

Protein-protein interaction databases

Structure

Family & Domains

Sequence similarities

Belongs to the noggin family.

Keywords

Phylogenomic databases

Family and domain databases

Sequence

  • Sequence status
    Fragment
  • Sequence processing
    The displayed sequence is further processed into a mature form.
  • Length
    144
  • Mass (Da)
    16,139
  • Last updated
    1996-11-01 v1
  • Checksum
    53BBE432B0D7298D
GGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWARYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

Computationally mapped potential isoform sequences

There is 1 potential isoform mapped to this entry

View all
EntryEntry nameGene nameLength
G3V8X8G3V8X8_RATNog232

Features

Showing features for non-terminal residue.

TypeIDPosition(s)Description
Non-terminal residue1

Keywords

Sequence databases

Nucleotide SequenceProtein SequenceMolecule TypeStatus
U31203
EMBL· GenBank· DDBJ
AAA83260.1
EMBL· GenBank· DDBJ
mRNA

Similar Proteins

Disclaimer

Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. Our staff consists of biologists and biochemists that are not trained to give medical advice.
We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.
FeedbackHelp