Q62440 · TLE1_MOUSE
- ProteinTransducin-like enhancer protein 1
- GeneTle1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids770 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional corepressor that binds to a number of transcription factors. Inhibits NF-kappa-B-regulated gene expression. Inhibits the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. Enhances FOXG1/BF-1- and HES1-mediated transcriptional repression (PubMed:16314515).
The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG (By similarity).
The effects of full-length TLE family members may be modulated by association with dominant-negative AES. Unusual function as coactivator for ESRRG (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Cellular Component | transcription regulator complex | |
Molecular Function | chromatin binding | |
Molecular Function | transcription corepressor activity | |
Biological Process | negative regulation of canonical NF-kappaB signal transduction | |
Biological Process | negative regulation of canonical Wnt signaling pathway | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II | |
Biological Process | Wnt signaling pathway |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTransducin-like enhancer protein 1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ62440
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000051277 | 1-770 | Transducin-like enhancer protein 1 | |||
Sequence: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSALSGQSHLAIKDDKKHHDAERHRDRESGTSNSLLVPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPDGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQIFSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY | ||||||
Modified residue | 237 | Phosphoserine; by CK2 | ||||
Sequence: S | ||||||
Modified residue | 257 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 261 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 265 | Phosphoserine; by CDK1 | ||||
Sequence: S | ||||||
Modified residue | 284 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Phosphorylated, probably by CDK1. The degree of phosphorylation varies throughout the cell cycle, and is highest at the G2/M transition. Becomes hyperphosphorylated in response to cell differentiation and interaction with HES1 or RUNX1.
Ubiquitinated by XIAP/BIRC4.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in liver and lung. Detected at slightly lower levels in heart, brain, kidney and testis. Detected in fetal and adult stomach and small intestine, in adult ileum, duodenum and colon. Expressed in bone marrow-derived macrophages (PubMed:23990468).
Isoform 7
Most abundant at the base of the crypts of Lieberkuhn in the small intestine.
Isoform 8
Most abundant at the base of the crypts of Lieberkuhn in the small intestine.
Gene expression databases
Interaction
Subunit
Homooligomer and heterooligomer with other family members. Binds RUNX1, RUNX3, FOXA2, KDM6A, UTY, histone H3, HESX1, ESRRG and the NF-kappa-B subunit RELA. Interacts with HES1 (via WRPW motif) (By similarity).
Binds TCF7, LEF1, TCF7L1 and TCF7L2 (PubMed:11266540).
Interacts with SIX3 (By similarity).
Interacts with EFNB1. Interacts with TLE4 (PubMed:16314515).
Interacts with FOXG1/BF-1; the interaction is inhibited by TLE6/GRG6 (PubMed:16314515).
Binds TCF7, LEF1, TCF7L1 and TCF7L2 (PubMed:11266540).
Interacts with SIX3 (By similarity).
Interacts with EFNB1. Interacts with TLE4 (PubMed:16314515).
Interacts with FOXG1/BF-1; the interaction is inhibited by TLE6/GRG6 (PubMed:16314515).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-131 | Q domain | ||||
Sequence: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIGQQQLQAQ | ||||||
Region | 128-157 | Disordered | ||||
Sequence: LQAQHLSHGHGPPVPLTPHPSGLQPPGIPP | ||||||
Region | 132-199 | GP domain | ||||
Sequence: HLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSALSGQSHLAIKDDKKHHDAERHRDRESGTS | ||||||
Compositional bias | 140-154 | Pro residues | ||||
Sequence: PVPLTPHPSGLQPPG | ||||||
Region | 176-346 | Disordered | ||||
Sequence: HLAIKDDKKHHDAERHRDRESGTSNSLLVPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAME | ||||||
Compositional bias | 177-197 | Basic and acidic residues | ||||
Sequence: LAIKDDKKHHDAERHRDRESG | ||||||
Region | 200-266 | CcN domain | ||||
Sequence: NSLLVPDSLRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVVDVSNEDPSSPHASPTHSP | ||||||
Compositional bias | 208-248 | Basic and acidic residues | ||||
Sequence: LRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVV | ||||||
Motif | 225-228 | Nuclear localization signal | ||||
Sequence: KKRK | ||||||
Compositional bias | 249-264 | Polar residues | ||||
Sequence: DVSNEDPSSPHASPTH | ||||||
Region | 267-450 | SP domain | ||||
Sequence: RENGIDKNRLLKKDASGSPASTASSGSSSSLKSKEVSLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPLAVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVGFDPPPHMRVPSIPPNLAGIPGGKPAYSFHV | ||||||
Compositional bias | 281-299 | Polar residues | ||||
Sequence: ASGSPASTASSGSSSSLKS | ||||||
Compositional bias | 309-329 | Polar residues | ||||
Sequence: NTPVLKSSTPTPRSDMPTPGT | ||||||
Repeat | 470-501 | WD 1 | ||||
Sequence: GIPRHARQINTLNHGEVVCAVTISNPTRHVYT | ||||||
Repeat | 528-558 | WD 2 | ||||
Sequence: NRDNYIRSCKLLPDGCTLIVGGEASTLSIWD | ||||||
Repeat | 572-602 | WD 3 | ||||
Sequence: SSAPACYALAISPDSKVCFSCCSDGNIAVWD | ||||||
Repeat | 614-644 | WD 4 | ||||
Sequence: GHTDGASCIDISNDGTKLWTGGLDNTVRSWD | ||||||
Repeat | 696-726 | WD 5 | ||||
Sequence: LHESCVLSLKFAYCGKWFVSTGKDNLLNAWR | ||||||
Repeat | 737-767 | WD 6 | ||||
Sequence: KESSSVLSCDISVDDKYIVTGSGDKKATVYE |
Domain
WD repeat Groucho/TLE family members are characterized by 5 regions, a glutamine-rich Q domain, a glycine/proline-rich GP domain, a central CcN domain, containing a nuclear localization signal, and a serine/proline-rich SP domain. The most highly conserved are the N-terminal Q domain and the C-terminal WD-repeat domain.
Sequence similarities
Belongs to the WD repeat Groucho/TLE family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 8 isoforms produced by Alternative splicing.
Q62440-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length770
- Mass (Da)83,097
- Last updated2003-03-25 v2
- Checksum65803C8F39BB0703
Q62440-2
- Name2
- Differences from canonical
- 125-198: Missing
Q62440-3
- Name3
- Differences from canonical
- 79-198: Missing
Q62440-4
- Name4
Q62440-5
- Name5
- Differences from canonical
- 1-41: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP
Q62440-6
- Name6
Q62440-7
- Name7
Q62440-8
- Name8
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for alternative sequence, sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_006987 | 1-41 | in isoform 5 | |||
Sequence: MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYH → MFTLSCLFCFP | ||||||
Sequence conflict | 48 | in Ref. 2; AAN77514 | ||||
Sequence: E → G | ||||||
Alternative sequence | VSP_006988 | 79-198 | in isoform 3 | |||
Sequence: Missing | ||||||
Sequence conflict | 92 | in Ref. 1; AAB49934 | ||||
Sequence: V → D | ||||||
Sequence conflict | 122 | in Ref. 2; AAN77518 | ||||
Sequence: I → T | ||||||
Alternative sequence | VSP_006989 | 125-198 | in isoform 2 and isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_006990 | 127 | in isoform 8 | |||
Sequence: Missing | ||||||
Compositional bias | 140-154 | Pro residues | ||||
Sequence: PVPLTPHPSGLQPPG | ||||||
Sequence conflict | 163 | in Ref. 1; AAB49934 | ||||
Sequence: S → G | ||||||
Compositional bias | 177-197 | Basic and acidic residues | ||||
Sequence: LAIKDDKKHHDAERHRDRESG | ||||||
Alternative sequence | VSP_006992 | 193-200 | in isoform 7 and isoform 8 | |||
Sequence: DRESGTSN → GERPGKPD | ||||||
Sequence conflict | 196 | in Ref. 1, 2; AAN77514/AAN77518 and 3; BAC35221 | ||||
Sequence: S → P | ||||||
Alternative sequence | VSP_006993 | 201-770 | in isoform 7 and isoform 8 | |||
Sequence: Missing | ||||||
Compositional bias | 208-248 | Basic and acidic residues | ||||
Sequence: LRSTDKRRNGPEFSSDIKKRKVDDKDNYDSDGDKSDDNLVV | ||||||
Sequence conflict | 210 | in Ref. 1, 2; AAN77519 and 3; BAC35221/BAC38509 | ||||
Sequence: S → G | ||||||
Sequence conflict | 247 | in Ref. 2; AAN77514 | ||||
Sequence: V → I | ||||||
Compositional bias | 249-264 | Polar residues | ||||
Sequence: DVSNEDPSSPHASPTH | ||||||
Sequence conflict | 258 | in Ref. 2; AAN77514/AAN77518 | ||||
Sequence: P → S | ||||||
Compositional bias | 281-299 | Polar residues | ||||
Sequence: ASGSPASTASSGSSSSLKS | ||||||
Compositional bias | 309-329 | Polar residues | ||||
Sequence: NTPVLKSSTPTPRSDMPTPGT | ||||||
Sequence conflict | 428 | in Ref. 2; AAN77518 | ||||
Sequence: R → S | ||||||
Sequence conflict | 464-465 | in Ref. 1; AAB49934 | ||||
Sequence: DA → MP | ||||||
Sequence conflict | 471 | in Ref. 1; AAB49934 | ||||
Sequence: I → F | ||||||
Alternative sequence | VSP_006991 | 477-658 | in isoform 4 | |||
Sequence: Missing | ||||||
Sequence conflict | 535 | in Ref. 1; AAB49934 | ||||
Sequence: S → T | ||||||
Sequence conflict | 542 | in Ref. 1; AAB49934 | ||||
Sequence: G → D | ||||||
Sequence conflict | 551 | in Ref. 2; AAN77517 | ||||
Sequence: A → T | ||||||
Sequence conflict | 612 | in Ref. 3; BAC35221 | ||||
Sequence: F → Y | ||||||
Alternative sequence | VSP_006994 | 649-653 | in isoform 6 | |||
Sequence: RQLQQ → NKSYQ | ||||||
Alternative sequence | VSP_006995 | 654-770 | in isoform 6 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U61362 EMBL· GenBank· DDBJ | AAB49934.1 EMBL· GenBank· DDBJ | mRNA | ||
AY155195 EMBL· GenBank· DDBJ | AAN77514.1 EMBL· GenBank· DDBJ | mRNA | ||
AY155196 EMBL· GenBank· DDBJ | AAN77515.1 EMBL· GenBank· DDBJ | mRNA | ||
AY155197 EMBL· GenBank· DDBJ | AAN77516.1 EMBL· GenBank· DDBJ | mRNA | ||
AY155198 EMBL· GenBank· DDBJ | AAN77517.1 EMBL· GenBank· DDBJ | mRNA | ||
AY155199 EMBL· GenBank· DDBJ | AAN77518.1 EMBL· GenBank· DDBJ | mRNA | ||
AY155200 EMBL· GenBank· DDBJ | AAN77519.1 EMBL· GenBank· DDBJ | mRNA | ||
AK046402 EMBL· GenBank· DDBJ | BAC32708.1 EMBL· GenBank· DDBJ | mRNA | ||
AK052961 EMBL· GenBank· DDBJ | BAC35221.1 EMBL· GenBank· DDBJ | mRNA | ||
AK076750 EMBL· GenBank· DDBJ | BAC36464.1 EMBL· GenBank· DDBJ | mRNA | ||
AK082499 EMBL· GenBank· DDBJ | BAC38509.1 EMBL· GenBank· DDBJ | mRNA | ||
AL773513 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. |