Q62419 · SH3G1_MOUSE
- ProteinEndophilin-A2
- GeneSh3gl1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids368 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Implicated in endocytosis. May recruit other proteins to membranes with high curvature (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | anchoring junction | |
Cellular Component | cell projection | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | early endosome membrane | |
Cellular Component | glutamatergic synapse | |
Cellular Component | hippocampal mossy fiber to CA3 synapse | |
Cellular Component | podosome | |
Cellular Component | postsynaptic density, intracellular component | |
Cellular Component | presynapse | |
Cellular Component | Schaffer collateral - CA1 synapse | |
Cellular Component | synapse | |
Molecular Function | beta-1 adrenergic receptor binding | |
Molecular Function | GTPase binding | |
Molecular Function | identical protein binding | |
Molecular Function | lipid binding | |
Molecular Function | phosphatase binding | |
Molecular Function | SH3 domain binding | |
Molecular Function | transmembrane transporter binding | |
Biological Process | modulation of excitatory postsynaptic potential | |
Biological Process | positive regulation of synaptic vesicle endocytosis | |
Biological Process | regulation of synaptic vesicle endocytosis | |
Biological Process | synaptic vesicle uncoating |
Keywords
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameEndophilin-A2
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ62419
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Early endosome membrane ; Peripheral membrane protein
Note: Associated with postsynaptic endosomes in hippocampal neurons.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000146745 | 1-368 | Endophilin-A2 | |||
Sequence: MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKDMEKKVDVTSKAVAEVLVRTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMVRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASSRPKREFKPRPREPFELGELEQPNGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVPLPQ | ||||||
Modified residue | 288 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 292 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 315 | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with ARC, SYNJ1 and DNM1. Interacts with PDCD6IP. Interacts with BIN2 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q62419 | Fau P62862 | 3 | EBI-642935, EBI-309546 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-21 | Membrane-binding amphipathic helix | ||||
Sequence: MSVAGLKKQFYKASQLVSEKV | ||||||
Domain | 18-249 | BAR | ||||
Sequence: SEKVGGAEGTKLDDDFKDMEKKVDVTSKAVAEVLVRTIEYLQPNPASRAKLTMLNTVSKIRGQVKNPGYPQSEGLLGECMVRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFIDPLQNLCDKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASS | ||||||
Region | 60-87 | Required for dimerization upon membrane association | ||||
Sequence: PNPASRAKLTMLNTVSKIRGQVKNPGYP | ||||||
Coiled coil | 180-250 | |||||
Sequence: DEELRQALEKFEESKEVAETSMHNLLETDIEQVSQLSALVDAQLDYHRQAVQILEELADKLKRRVREASSR | ||||||
Region | 218-254 | Interaction with ARC | ||||
Sequence: LVDAQLDYHRQAVQILEELADKLKRRVREASSRPKRE | ||||||
Compositional bias | 244-265 | Basic and acidic residues | ||||
Sequence: VREASSRPKREFKPRPREPFEL | ||||||
Region | 244-307 | Disordered | ||||
Sequence: VREASSRPKREFKPRPREPFELGELEQPNGGFPCAPAPKITASSSFRSSDKPIRMPSKSMPPLD | ||||||
Domain | 306-365 | SH3 | ||||
Sequence: LDQPSCKALYDFEPENDGELGFREGDLITLTNQIDENWYEGMLHGQSGFFPLSYVQVLVP |
Domain
An N-terminal amphipathic helix, the BAR domain and a second amphipathic helix inserted into helix 1 of the BAR domain (N-BAR domain) induce membrane curvature and bind curved membranes.
Sequence similarities
Belongs to the endophilin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length368
- Mass (Da)41,518
- Last updated1996-11-01 v1
- Checksum3F753B1669086353
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3B2W7K0 | A0A3B2W7K0_MOUSE | Sh3gl1 | 247 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 244-265 | Basic and acidic residues | ||||
Sequence: VREASSRPKREFKPRPREPFEL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U58885 EMBL· GenBank· DDBJ | AAC71775.1 EMBL· GenBank· DDBJ | mRNA |