Q61735 · CD47_MOUSE
- ProteinLeukocyte surface antigen CD47
- GeneCd47
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids303 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Adhesive protein that mediates cell-to-cell interactions (By similarity).
Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (By similarity).
Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation (PubMed:20610415, PubMed:23591719, PubMed:27742621).
Plays a role in modulating pulmonary endothelin EDN1 signaling (PubMed:27742621).
Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure (PubMed:20610415).
Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity).
Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells (By similarity).
Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation (By similarity).
Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering (PubMed:15917238).
Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging (PubMed:32679764).
In response to THBS1, negatively modulates wound healing (PubMed:18156939).
Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (PubMed:23591719).
May play a role in membrane transport and/or integrin dependent signal transduction (By similarity).
May prevent premature elimination of red blood cells (PubMed:10856220).
Acts as a receptor for thrombospondin THBS1 and as modulator of integrin signaling through the activation of heterotrimeric G proteins (By similarity).
Involved in signal transduction, cardiovascular homeostasis, inflammation, apoptosis, angiogenesis, cellular self-renewal, and immunoregulation (PubMed:20610415, PubMed:23591719, PubMed:27742621).
Plays a role in modulating pulmonary endothelin EDN1 signaling (PubMed:27742621).
Modulates nitrous oxide (NO) signaling, in response to THBS1, hence playing a role as a pressor agent, supporting blood pressure (PubMed:20610415).
Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity).
Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells (By similarity).
Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation (By similarity).
Positively modulates FAS-dependent apoptosis in T-cells, perhaps by enhancing FAS clustering (PubMed:15917238).
Plays a role in suppressing angiogenesis and may be involved in metabolic dysregulation during normal aging (PubMed:32679764).
In response to THBS1, negatively modulates wound healing (PubMed:18156939).
Inhibits stem cell self-renewal, in response to THBS1, probably by regulation of the stem cell transcription factors POU5F1/OCT4, SOX2, MYC/c-Myc and KLF4 (PubMed:23591719).
May play a role in membrane transport and/or integrin dependent signal transduction (By similarity).
May prevent premature elimination of red blood cells (PubMed:10856220).
GO annotations
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLeukocyte surface antigen CD47
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ61735
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 19-140 | Extracellular | ||||
Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK | ||||||
Transmembrane | 141-161 | Helical | ||||
Sequence: ILIVIFPILAILLFWGKFGIL | ||||||
Topological domain | 162-173 | Cytoplasmic | ||||
Sequence: TLKYKSSHTNKR | ||||||
Transmembrane | 174-194 | Helical | ||||
Sequence: IILLLVAGLVLTVIVVVGAIL | ||||||
Topological domain | 195-206 | Extracellular | ||||
Sequence: LIPGEKPVKNAS | ||||||
Transmembrane | 207-227 | Helical | ||||
Sequence: GLGLIVISTGILILLQYNVFM | ||||||
Topological domain | 228-238 | Cytoplasmic | ||||
Sequence: TAFGMTSFTIA | ||||||
Transmembrane | 239-259 | Helical | ||||
Sequence: ILITQVLGYVLALVGLCLCIM | ||||||
Topological domain | 260-266 | Extracellular | ||||
Sequence: ACEPVHG | ||||||
Transmembrane | 267-287 | Helical | ||||
Sequence: PLLISGLGIIALAELLGLVYM | ||||||
Topological domain | 288-303 | Cytoplasmic | ||||
Sequence: KFVASNQRTIQPPRNR |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Knockout endothelial cells have increased basal endothelial NO synthase (eNOS) activity (PubMed:20610415).
Abnormally low resting mean arterial pressure (MAP), systolic blood pressure (SBP), and diastolic blood pressure (DBP) (PubMed:20610415).
Endothelin receptors EDNRA and EDNRB are significantly decreased in blood vessels (PubMed:20610415).
Suppresses hypoxia-mediated increase in right-ventricle maximum systolic pressure and pulmonary arterial thickening (PubMed:27742621).
Suppresses hypoxia-mediated induction of pulmonary endothelin EDN1 and endothelin receptor EDNRA (PubMed:27742621).
Abolishes age-associated induction of arterial THBS1 mRNA (PubMed:32679764).
Increased proliferation and migration of arterial endothelial cells and enhanced sprouting angiogenesis (PubMed:32679764).
Increased expression of matrix metalloproteinases MMP2 and MMP9 in endothelial cells from aged mice (at protein level) (PubMed:32679764).
Improved glucose tolerance and insulin sensitivity in aged individuals by comparison with age-matched controls (PubMed:32679764).
Enhanced survival of full-thickness skin grafts, with increased numbers of functional vessels in wound beds (PubMed:18156939).
Increased mRNA levels for POU5F1/Oct4, SOX2, MYC/c-Myc, KLF4 and NES/Nestin; significant up-regulation in spleen; moderately increased expression in lung, except for KLF4 (PubMed:23591719).
Abnormally low resting mean arterial pressure (MAP), systolic blood pressure (SBP), and diastolic blood pressure (DBP) (PubMed:20610415).
Endothelin receptors EDNRA and EDNRB are significantly decreased in blood vessels (PubMed:20610415).
Suppresses hypoxia-mediated increase in right-ventricle maximum systolic pressure and pulmonary arterial thickening (PubMed:27742621).
Suppresses hypoxia-mediated induction of pulmonary endothelin EDN1 and endothelin receptor EDNRA (PubMed:27742621).
Abolishes age-associated induction of arterial THBS1 mRNA (PubMed:32679764).
Increased proliferation and migration of arterial endothelial cells and enhanced sprouting angiogenesis (PubMed:32679764).
Increased expression of matrix metalloproteinases MMP2 and MMP9 in endothelial cells from aged mice (at protein level) (PubMed:32679764).
Improved glucose tolerance and insulin sensitivity in aged individuals by comparison with age-matched controls (PubMed:32679764).
Enhanced survival of full-thickness skin grafts, with increased numbers of functional vessels in wound beds (PubMed:18156939).
Increased mRNA levels for POU5F1/Oct4, SOX2, MYC/c-Myc, KLF4 and NES/Nestin; significant up-regulation in spleen; moderately increased expression in lung, except for KLF4 (PubMed:23591719).
Chemistry
PTM/Processing
Features
Showing features for signal, modified residue, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-18 | |||||
Sequence: MWPLAAALLLGSCCCGSA | ||||||
Modified residue | 19 | Pyrrolidone carboxylic acid | ||||
Sequence: Q | ||||||
Chain | PRO_0000042206 | 19-303 | Leukocyte surface antigen CD47 | |||
Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPGEKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCIMACEPVHGPLLISGLGIIALAELLGLVYMKFVASNQRTIQPPRNR | ||||||
Disulfide bond | 33↔261 | |||||
Sequence: CNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKILIVIFPILAILLFWGKFGILTLKYKSSHTNKRIILLLVAGLVLTVIVVVGAILLIPGEKPVKNASGLGLIVISTGILILLQYNVFMTAFGMTSFTIAILITQVLGYVLALVGLCLCIMAC | ||||||
Glycosylation | 34 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 41↔112 | |||||
Sequence: CIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTC | ||||||
Glycosylation | 61 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 73 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 80 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Modified residue | 87 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 89 | Phosphoserine | ||||
Sequence: S | ||||||
Glycosylation | 109 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 129 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 204 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Monomer (By similarity).
Interacts with THBS1 (via the C-terminal domain) (By similarity).
Interacts with SIRPA (PubMed:10856220).
Interacts with FAS/CD95; interaction may be enhanced by functional activation (By similarity).
Interacts with SIRPG, UBQLN1 and UBQLN2 (By similarity).
May interact with fibrinogen (By similarity).
Interacts with THBS1 (via the C-terminal domain) (By similarity).
Interacts with SIRPA (PubMed:10856220).
Interacts with FAS/CD95; interaction may be enhanced by functional activation (By similarity).
Interacts with SIRPG, UBQLN1 and UBQLN2 (By similarity).
May interact with fibrinogen (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-125 | Ig-like V-type | ||||
Sequence: QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVI |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
Q61735-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length303
- Mass (Da)33,098
- Last updated2005-09-27 v2
- Checksum87C0E6EF758FFF58
Q61735-2
- Name2
- Differences from canonical
- 131-131: T → TAFNTDQGSACSYEEEKGGCKL
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2R8VI30 | A0A2R8VI30_MOUSE | Cd47 | 267 | ||
A0A2R8VK70 | A0A2R8VK70_MOUSE | Cd47 | 321 | ||
A0A2R8VJU9 | A0A2R8VJU9_MOUSE | Cd47 | 258 | ||
A0A2R8VI94 | A0A2R8VI94_MOUSE | Cd47 | 278 | ||
A0A2R8W6P0 | A0A2R8W6P0_MOUSE | Cd47 | 342 | ||
D3Z187 | D3Z187_MOUSE | Cd47 | 271 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_015793 | 131 | in isoform 2 | |||
Sequence: T → TAFNTDQGSACSYEEEKGGCKL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z25524 EMBL· GenBank· DDBJ | CAA80978.1 EMBL· GenBank· DDBJ | mRNA | ||
AB012693 EMBL· GenBank· DDBJ | BAA25401.1 EMBL· GenBank· DDBJ | mRNA | ||
BC009094 EMBL· GenBank· DDBJ | AAH09094.1 EMBL· GenBank· DDBJ | mRNA | ||
BC012667 EMBL· GenBank· DDBJ | AAH12667.1 EMBL· GenBank· DDBJ | mRNA |