Q61502 · E2F5_MOUSE
- ProteinTranscription factor E2F5
- GeneE2f5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids335 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional activator that binds to E2F sites, these sites are present in the promoter of many genes whose products are involved in cell proliferation. May mediate growth factor-initiated signal transduction. It is likely involved in the early responses of resting cells to growth factor stimulation. Specifically required for multiciliate cell differentiation: together with MCIDAS and E2F5, binds and activate genes required for centriole biogenesis.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 37-108 | |||||
Sequence: GSSRHEKSLGLLTTKFVSLLQEAQDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVG |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | fibrillar center | |
Cellular Component | nuclear envelope | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | RNA polymerase II transcription regulator complex | |
Cellular Component | sarcoplasm | |
Molecular Function | DNA-binding transcription activator activity | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Biological Process | animal organ morphogenesis | |
Biological Process | cell projection organization | |
Biological Process | G1/S transition of mitotic cell cycle | |
Biological Process | regulation of cell cycle | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor E2F5
- Short namesE2F-5
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ61502
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000219470 | 1-335 | Transcription factor E2F5 | |||
Sequence: MAAAEPTSSAQPTPQAQAQPPPHGAPSSQPSAALAGGSSRHEKSLGLLTTKFVSLLQEAQDGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRCLKAEIEDLELKERELDQQKLWLQQSIKNVMEDSINNRFSYVTHEDICNCFHGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY |
Proteomic databases
PTM databases
Expression
Developmental stage
In the developing epidermis, first detected in 13.5-14.5 dpc embryos. With the appearance of stratified epithelium, levels of E2F5 expression increase and by 16.5 dpc, high expression found in the suprabasal cell layers. High expression also found in other regions with stratified squamous epithelia including the developing palate, lip and tongue. In the developing nervous system, first detected in the forebrain at 9.5 dpc. At 10.5 dpc, strongly expressed in the rostral region of the spinal cord. By 11.5 dpc, E2F5 is expressed throughout the developing central nervous system. In 12.5-15.5 dpc embryos, expression found in the undifferentiated ventricular regions of the brain. In the retina, expressed, in 14.5-18.5 dpc embryos, in the retinoblastic cell layer. In other developing tissues, highly expressed in the choroid plexus. Also found in the kidney, liver, lung, heart and weakly, in developing skeletal muscle and chondrocytes.
Gene expression databases
Interaction
Subunit
Component of the DRTF1/E2F transcription factor complex. Binds cooperatively with DP-1 to E2F sites. Interaction with retinoblastoma protein RB1 or proteins RBL1 and RBL2 inhibits the E2F transactivation domain. Component of the DREAM complex (also named LINC complex) at least composed of E2F4, E2F5, LIN9, LIN37, LIN52, LIN54, MYBL1, MYBL2, RBL1, RBL2, RBBP4, TFDP1 and TFDP2. The complex exists in quiescent cells where it represses cell cycle-dependent genes. It dissociates in S phase when LIN9, LIN37, LIN52 and LIN54 form a subcomplex that binds to MYBL2 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q61502 | Tfdp2 Q64163-4 | 2 | EBI-7225685, EBI-8077763 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, motif, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-40 | Disordered | ||||
Sequence: MAAAEPTSSAQPTPQAQAQPPPHGAPSSQPSAALAGGSSR | ||||||
Region | 66-88 | Leucine-zipper | ||||
Sequence: LKAAADTLAVRQKRRIYDITNVL | ||||||
Motif | 71-108 | DEF box | ||||
Sequence: DTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVG | ||||||
Region | 109-205 | Dimerization | ||||
Sequence: AGCNTKEVIDRLRCLKAEIEDLELKERELDQQKLWLQQSIKNVMEDSINNRFSYVTHEDICNCFHGDTLLAIQAPSGTQLEVPIPEMGQNGQKKYQI | ||||||
Region | 226-285 | Disordered | ||||
Sequence: SKPVVFPVPPPDDLTQPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSG | ||||||
Compositional bias | 240-284 | Polar residues | ||||
Sequence: TQPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSS | ||||||
Region | 277-335 | Transactivation | ||||
Sequence: TPAAEVSSGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY | ||||||
Region | 312-329 | RBL2 association | ||||
Sequence: DDYNFNLDDNEGVCDLFD |
Sequence similarities
Belongs to the E2F/DP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length335
- Mass (Da)36,555
- Last updated2011-07-27 v2
- Checksum7922ACE79C73944B
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 32-35 | in Ref. 1; CAA60508 | ||||
Sequence: AALA → RRSR | ||||||
Compositional bias | 240-284 | Polar residues | ||||
Sequence: TQPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
X86925 EMBL· GenBank· DDBJ | CAA60508.1 EMBL· GenBank· DDBJ | mRNA | ||
AK156760 EMBL· GenBank· DDBJ | BAE33842.1 EMBL· GenBank· DDBJ | mRNA | ||
BC003220 EMBL· GenBank· DDBJ | AAH03220.1 EMBL· GenBank· DDBJ | mRNA |