Q61490 · CD166_MOUSE
- ProteinCD166 antigen
- GeneAlcam
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids583 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts. Promotes T-cell activation and proliferation via its interactions with CD6 (By similarity).
Contributes to the formation and maturation of the immunological synapse via its interactions with CD6 (By similarity).
Mediates homotypic interactions with cells that express ALCAM (PubMed:24740813).
Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction. Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions (PubMed:23169771).
Required for normal organization of the lymph vessel network (PubMed:23169771).
Required for normal hematopoietic stem cell engraftment in the bone marrow (PubMed:24740813).
Plays a role in hematopoiesis; required for normal numbers of hematopoietic stem cells in bone marrow (PubMed:25730656).
Promotes in vitro osteoblast proliferation and differentiation (PubMed:25730656).
Promotes neurite extension, axon growth and axon guidance; axons grow preferentially on surfaces that contain ALCAM (By similarity).
Mediates outgrowth and pathfinding for retinal ganglion cell axons (PubMed:15345243).
Contributes to the formation and maturation of the immunological synapse via its interactions with CD6 (By similarity).
Mediates homotypic interactions with cells that express ALCAM (PubMed:24740813).
Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction. Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions (PubMed:23169771).
Required for normal organization of the lymph vessel network (PubMed:23169771).
Required for normal hematopoietic stem cell engraftment in the bone marrow (PubMed:24740813).
Plays a role in hematopoiesis; required for normal numbers of hematopoietic stem cells in bone marrow (PubMed:25730656).
Promotes in vitro osteoblast proliferation and differentiation (PubMed:25730656).
Promotes neurite extension, axon growth and axon guidance; axons grow preferentially on surfaces that contain ALCAM (By similarity).
Mediates outgrowth and pathfinding for retinal ganglion cell axons (PubMed:15345243).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | dendrite | |
Cellular Component | external side of plasma membrane | |
Cellular Component | immunological synapse | |
Cellular Component | neuronal cell body | |
Cellular Component | plasma membrane | |
Cellular Component | T cell receptor complex | |
Molecular Function | identical protein binding | |
Biological Process | adaptive immune response | |
Biological Process | axon extension involved in axon guidance | |
Biological Process | axon guidance | |
Biological Process | cell adhesion | |
Biological Process | heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules | |
Biological Process | motor neuron axon guidance | |
Biological Process | neuron projection extension | |
Biological Process | retinal ganglion cell axon guidance |
Keywords
- Biological process
Names & Taxonomy
Protein names
- Recommended nameCD166 antigen
- Alternative names
- CD Antigen Name
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ61490
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Note: Detected at the immunological synapse, i.e, at the contact zone between antigen-presenting dendritic cells and T-cells. Colocalizes with CD6 and the TCR/CD3 complex at the immunological synapse.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 28-527 | Extracellular | ||||
Sequence: WYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSIANAKISDEKRFVCMLVTEDNVFEAPTLVKVFKQPSKPEIVNKAPFLETDQLKKLGDCISRDSYPDGNITWYRNGKVLQPVEGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTCSVTYYGPSGQKTIYSEQEIFDIYYPTEQVTIQVLPPKNAIKEGDNITLQCLGNGNPPPEEFMFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKRNMAASTTITVHYLDLSLNPSGEVTKQIGDTLPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEADDISDENREKVNDQAK | ||||||
Transmembrane | 528-549 | Helical | ||||
Sequence: LIVGIVVGLLLAALVAGVVYWL | ||||||
Topological domain | 550-583 | Cytoplasmic | ||||
Sequence: YMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA |
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Mice are born at the expected Mendelian rate, are viable and fertile and display no obvious external phenotype. Unlike wild-type mice, that have tightly fasciculated and smooth nerve bundles, mutant mice have more loosely bundled nerves with many single axons extending out of the main nerve. Eyes from mutant mice display a variable degree of retinal displasia (PubMed:15345243).
Besides, lymph nodes from mutant mice display reduced weight and cellularity, but appear otherwise normal (PubMed:23169771).
Mutant mice have only half of the normal number of hematopoietic stem cells in their bone marrow (PubMed:24740813, PubMed:25730656).
Survival of lethally irradiated mice that receive bone marrow from mutant mice is impaired, due to impaired homotypic cell-cell attachment, impaired engraftment and proliferation of mutant hematopoietic stem cells (PubMed:24740813).
Mutant mice are larger and heavier than wild-type and have increased bone mineral density (PubMed:25730656).
Mutant spleen has an altered leukocyte composition, with reduced numbers of CD4+ and CD8+ T-cells, B-cells, dendritic cells, neutrophils and macrophages, but no change in the total leukocyte number. Their lungs display reduced numbers of lymph vessel and blood vessel endothelial cells, but no difference in lung weight. Lymph vessels in mesentery and diaphragm are more densely interconnected and show a decreased level of hierarchical vascular organization in mutant mice (PubMed:23169771).
Besides, lymph nodes from mutant mice display reduced weight and cellularity, but appear otherwise normal (PubMed:23169771).
Mutant mice have only half of the normal number of hematopoietic stem cells in their bone marrow (PubMed:24740813, PubMed:25730656).
Survival of lethally irradiated mice that receive bone marrow from mutant mice is impaired, due to impaired homotypic cell-cell attachment, impaired engraftment and proliferation of mutant hematopoietic stem cells (PubMed:24740813).
Mutant mice are larger and heavier than wild-type and have increased bone mineral density (PubMed:25730656).
Mutant spleen has an altered leukocyte composition, with reduced numbers of CD4+ and CD8+ T-cells, B-cells, dendritic cells, neutrophils and macrophages, but no change in the total leukocyte number. Their lungs display reduced numbers of lymph vessel and blood vessel endothelial cells, but no difference in lung weight. Lymph vessels in mesentery and diaphragm are more densely interconnected and show a decreased level of hierarchical vascular organization in mutant mice (PubMed:23169771).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 15 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-27 | |||||
Sequence: MASKVSPSCRLVFCLLISAAVLRPGLG | ||||||
Chain | PRO_0000014660 | 28-583 | CD166 antigen | |||
Sequence: WYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSIANAKISDEKRFVCMLVTEDNVFEAPTLVKVFKQPSKPEIVNKAPFLETDQLKKLGDCISRDSYPDGNITWYRNGKVLQPVEGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTCSVTYYGPSGQKTIYSEQEIFDIYYPTEQVTIQVLPPKNAIKEGDNITLQCLGNGNPPPEEFMFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKRNMAASTTITVHYLDLSLNPSGEVTKQIGDTLPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEADDISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA | ||||||
Disulfide bond | 43↔113 | |||||
Sequence: CRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSIANAKISDEKRFVC | ||||||
Glycosylation | 95 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 157↔220 | |||||
Sequence: CISRDSYPDGNITWYRNGKVLQPVEGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTC | ||||||
Glycosylation | 167 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 265 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 270↔313 | |||||
Sequence: CLGNGNPPPEEFMFYLPGQPEGIRSSNTYTLTDVRRNATGDYKC | ||||||
Glycosylation | 306 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 354↔392 | |||||
Sequence: CTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVC | ||||||
Glycosylation | 361 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 435↔485 | |||||
Sequence: CHVEGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTC | ||||||
Glycosylation | 457 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 480 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 499 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Post-translational modification
Glycosylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected on brain motor neurons, in differentiating retinal ganglion cells and in adult retina (PubMed:15345243).
Detected on leukocytes and on lymphatic endothelial cells (PubMed:23169771).
Detected in spleen B cells and T-cells (at protein level) (PubMed:9209500).
Detected in adult brain and embryonic spinal cord (PubMed:15345243).
Expressed at high levels in the brain, and lung, and at lower levels in the liver, and the kidney, as well as by activated leukocytes (PubMed:9209500).
Detected on leukocytes and on lymphatic endothelial cells (PubMed:23169771).
Detected in spleen B cells and T-cells (at protein level) (PubMed:9209500).
Detected in adult brain and embryonic spinal cord (PubMed:15345243).
Expressed at high levels in the brain, and lung, and at lower levels in the liver, and the kidney, as well as by activated leukocytes (PubMed:9209500).
Gene expression databases
Interaction
Subunit
Homodimer (By similarity).
Interacts (via extracellular domain) with CD6 (via extracellular domain) (PubMed:16914752, PubMed:9209500).
Homodimerization and interaction with CD6 involve the same region and cannot occur simultaneously. The affinity for CD6 is much higher than the affinity for self-association. Interacts (via glycosylated extracellular domain) with LGALS1 and LGALS3. Interaction with LGALS1 or LGALS3 inhibits interaction with CD6
Interacts (via extracellular domain) with CD6 (via extracellular domain) (PubMed:16914752, PubMed:9209500).
Homodimerization and interaction with CD6 involve the same region and cannot occur simultaneously. The affinity for CD6 is much higher than the affinity for self-association. Interacts (via glycosylated extracellular domain) with LGALS1 and LGALS3. Interaction with LGALS1 or LGALS3 inhibits interaction with CD6
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 28-120 | Ig-like V-type 1 | ||||
Sequence: WYTVNSAYGDTIVMPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLSLSENYTLSIANAKISDEKRFVCMLVTEDN | ||||||
Domain | 125-234 | Ig-like V-type 2 | ||||
Sequence: PTLVKVFKQPSKPEIVNKAPFLETDQLKKLGDCISRDSYPDGNITWYRNGKVLQPVEGEVAILFKKEIDPGTQLYTVTSSLEYKTTRSDIQMPFTCSVTYYGPSGQKTIY | ||||||
Domain | 245-328 | Ig-like C2-type 1 | ||||
Sequence: PTEQVTIQVLPPKNAIKEGDNITLQCLGNGNPPPEEFMFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKRNMAASTTIT | ||||||
Domain | 333-409 | Ig-like C2-type 2 | ||||
Sequence: DLSLNPSGEVTKQIGDTLPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLT | ||||||
Domain | 416-501 | Ig-like C2-type 3 | ||||
Sequence: PQIKMTKKTDPSGLSKTIICHVEGFPKPAIHWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVS | ||||||
Region | 562-583 | Disordered | ||||
Sequence: NKDLGNMEENKKLEENNHKTEA |
Domain
The CD6 binding site is located in the N-terminal Ig-like domain.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length583
- Mass (Da)65,092
- Last updated2004-05-24 v3
- Checksum570AFA8FCAF888F8
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 8 | in Ref. 2; BAC27159 | ||||
Sequence: S → C | ||||||
Sequence conflict | 227-232 | in Ref. 4; AAA37528 | ||||
Sequence: PSGQKT → AAGIPA | ||||||
Sequence conflict | 339 | in Ref. 1 and 4 | ||||
Sequence: S → R | ||||||
Sequence conflict | 451 | in Ref. 2; BAC27159 | ||||
Sequence: G → S | ||||||
Sequence conflict | 454 | in Ref. 4; AAA37528 | ||||
Sequence: S → F |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U95030 EMBL· GenBank· DDBJ | AAC06342.1 EMBL· GenBank· DDBJ | mRNA | ||
AK030851 EMBL· GenBank· DDBJ | BAC27159.1 EMBL· GenBank· DDBJ | mRNA | ||
AK031391 EMBL· GenBank· DDBJ | BAC27382.1 EMBL· GenBank· DDBJ | mRNA | ||
BC027280 EMBL· GenBank· DDBJ | AAH27280.1 EMBL· GenBank· DDBJ | mRNA | ||
L25274 EMBL· GenBank· DDBJ | AAA37528.1 EMBL· GenBank· DDBJ | mRNA |