Q61169 · GATA6_MOUSE
- ProteinTranscription factor GATA-6
- GeneGata6
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids589 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional activator that regulates SEMA3C and PLXNA2 (PubMed:19666519).
May regulate genes that protect epithelial cells from bacterial infection (By similarity).
Involved in gene regulation specifically in the gastric epithelium (By similarity).
Involved in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression (PubMed:15329343).
Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (PubMed:15329343).
May regulate genes that protect epithelial cells from bacterial infection (By similarity).
Involved in gene regulation specifically in the gastric epithelium (By similarity).
Involved in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression (PubMed:15329343).
Binds to BMP response element (BMPRE) DNA sequences within cardiac activating regions (PubMed:15329343).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor GATA-6
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ61169
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000083424 | 1-589 | Transcription factor GATA-6 | |||
Sequence: MALTDGGWCLPKRFGAAAADAGDSGPFPAREPSSPLSPISSSSSSCSRGGDRGPCGASNCRTPQLDAEAVAGPPGRSLLLSPYASHPFAAAHGAAAPGVAGPGSALSTWEDLLLFTDLDQAATASKLLWSSRGAKLSPFAAEQPEEMYQTLAALSSQGPAAYDGAPGGFVHSAAAAAAAAAAASSPVYVPTTRVGSMLSGLPYLQGAGSGPSNHAGGAGAHPGWSQASADSPPYGGGGAAGGGAAGPGGAGSATAHASARFPYSPSPPMANGAARDPGGYVAAGGTGAGSVSGGGGSLAAMGGREHQYSSLSAARPLNGTYHHHHHHHPTYSPYMAAPLTPAWPAGPFETPVLHSLQGRAGAPLPVPRGPSTDLLEDLSESRECVNCGSIQTPLWRRDGTGHYLCNACGLYSKMNGLSRPLIKPQKRVPSSRRLGLSCANCHTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMKKEGIQTRKRKPKNINKSKACSGNSSGSVPMTPTSSSSNSDDCTKNTSPSTQATTSGVGASVMSAVGENANPENSDLKYSGQDGLYIGVSLSSPAEVTSSVRQDSWCALALA | ||||||
Modified residue | 266 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 423 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 467 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 478 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in myocardium, vascular smooth muscle, gut epithelium, and osteoclasts.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 17-62 | Disordered | ||||
Sequence: AAADAGDSGPFPAREPSSPLSPISSSSSSCSRGGDRGPCGASNCRT | ||||||
Compositional bias | 34-49 | Polar residues | ||||
Sequence: SPLSPISSSSSSCSRG | ||||||
Region | 209-274 | Disordered | ||||
Sequence: SGPSNHAGGAGAHPGWSQASADSPPYGGGGAAGGGAAGPGGAGSATAHASARFPYSPSPPMANGAA | ||||||
Zinc finger | 384-408 | GATA-type 1 | ||||
Sequence: CVNCGSIQTPLWRRDGTGHYLCNAC | ||||||
Zinc finger | 438-462 | GATA-type 2 | ||||
Sequence: CANCHTTTTTLWRRNAEGEPVCNAC | ||||||
Region | 479-534 | Disordered | ||||
Sequence: KEGIQTRKRKPKNINKSKACSGNSSGSVPMTPTSSSSNSDDCTKNTSPSTQATTSG | ||||||
Compositional bias | 494-534 | Polar residues | ||||
Sequence: KSKACSGNSSGSVPMTPTSSSSNSDDCTKNTSPSTQATTSG |
Domain
The GATA-type zinc fingers mediate interaction with LMCD1.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative initiation.
Q61169-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length589
- Mass (Da)59,307
- Last updated2008-11-25 v3
- Checksum1A55474DA65EC6ED
Q61169-2
- Name2
- NoteProduced by alternative initiation at Met-147 of isoform 1.
- Differences from canonical
- 1-146: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A3Q4L2W4 | A0A3Q4L2W4_MOUSE | Gata6 | 161 | ||
A0A3Q4EHT4 | A0A3Q4EHT4_MOUSE | Gata6 | 63 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_035779 | 1-146 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 34-49 | Polar residues | ||||
Sequence: SPLSPISSSSSSCSRG | ||||||
Sequence conflict | 297 | in Ref. 1; AAB37426 | ||||
Sequence: S → T | ||||||
Sequence conflict | 416 | in Ref. 5; AAC52841 | ||||
Sequence: G → A | ||||||
Compositional bias | 494-534 | Polar residues | ||||
Sequence: KSKACSGNSSGSVPMTPTSSSSNSDDCTKNTSPSTQATTSG | ||||||
Sequence conflict | 536 | in Ref. 5; AAC52841 | ||||
Sequence: G → R | ||||||
Sequence conflict | 538 | in Ref. 5; AAC52841 | ||||
Sequence: Missing | ||||||
Sequence conflict | 546 | in Ref. 5; AAC52841 | ||||
Sequence: N → K | ||||||
Sequence conflict | 589 | in Ref. 1; AAB37426 and 2; AAD55267 | ||||
Sequence: A → V |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S82462 EMBL· GenBank· DDBJ | AAB37426.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF179425 EMBL· GenBank· DDBJ | AAD55267.1 EMBL· GenBank· DDBJ | mRNA | ||
AK142381 EMBL· GenBank· DDBJ | BAE25049.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466592 EMBL· GenBank· DDBJ | EDL22985.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U51335 EMBL· GenBank· DDBJ | AAC52841.1 EMBL· GenBank· DDBJ | mRNA | Frameshift |