Q61127 · NAB2_MOUSE
- ProteinNGFI-A-binding protein 2
- GeneNab2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids525 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a transcriptional repressor for zinc finger transcription factors EGR1 and EGR2. Isoform 2 lacks repression ability.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | identical protein binding | |
Molecular Function | transcription coregulator activity | |
Biological Process | endochondral ossification | |
Biological Process | myelination | |
Biological Process | negative regulation of transcription by RNA polymerase III | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of epidermis development | |
Biological Process | Schwann cell differentiation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNGFI-A-binding protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ61127
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain, modified residue, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000077043 | 1-525 | NGFI-A-binding protein 2 | |||
Sequence: MHRAPSPTAEQPPGRGDNTRRTPQPRFKASAPAMALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAVPVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGQSTPESDVGAGGEEEAGSPPFSPPAGGGVSEGPGVGGVAAGGAGGGPDRLEPEMVRMVVESVERIFRSFPRGDTGEIASLLKLNKKLARSVGHIFEMDDHDAQKEEEIRKYSVIYGRLDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSLKGSRLHSEELGGPPLKKLKQEVGEQSHNEIQQPPPGPESYAPPYRPSLEEDSASLSGESLDGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSPCVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ | ||||||
Modified residue | 6 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 157 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 159 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 162 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 171 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 379 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1) | ||||
Sequence: K | ||||||
Modified residue | 479 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 517 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | ||||||
Cross-link | 517 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K |
Post-translational modification
Sumoylation by EGR2 represses EGR2 transcriptional activity in hindbrain.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highly expressed in brain and thymus, and at lower levels in spleen, kidney, heart and testis. Isoform 1 is predominantly expressed in testis, whereas isoform 3 is more abundant in thymus.
Induction
By serum stimulation.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-31 | Disordered | ||||
Sequence: MHRAPSPTAEQPPGRGDNTRRTPQPRFKASA | ||||||
Region | 35-113 | NCD1 | ||||
Sequence: ALPRTLGELQLYRVLQRANLLSYYETFIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLF | ||||||
Region | 135-238 | Disordered | ||||
Sequence: GTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAGDPRIWPGQSTPESDVGAGGEEEAGSPPFSPPAGGGVSEGPGVGGVAAGGAGGGPDRLE | ||||||
Region | 267-356 | NCD2 | ||||
Sequence: LLKLNKKLARSVGHIFEMDDHDAQKEEEIRKYSVIYGRLDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTY | ||||||
Region | 353-384 | Necessary for nuclear localization | ||||
Sequence: ESTYLSSLKGSRLHSEELGGPPLKKLKQEVGE | ||||||
Region | 381-416 | Disordered | ||||
Sequence: EVGEQSHNEIQQPPPGPESYAPPYRPSLEEDSASLS | ||||||
Region | 501-525 | Disordered | ||||
Sequence: APGPHPALVEGRRSSVKVEAEASRQ |
Domain
The NAB conserved domain 1 (NCD1) interacts with EGR1 inhibitory domain and mediates multimerization.
The NAB conserved domain 2 (NCD2) is necessary for transcriptional repression.
Sequence similarities
Belongs to the NAB family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q61127-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length525
- Mass (Da)56,577
- Last updated2011-07-27 v2
- Checksum4FFA510C8E39DF70
Q61127-2
- Name2
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U47543 EMBL· GenBank· DDBJ | AAC52650.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466578 EMBL· GenBank· DDBJ | EDL24515.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC045139 EMBL· GenBank· DDBJ | AAH45139.1 EMBL· GenBank· DDBJ | mRNA |