Q61066 · NR0B1_MOUSE
- ProteinNuclear receptor subfamily 0 group B member 1
- GeneNr0b1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids472 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Orphan nuclear receptor. Component of a cascade required for the development of the hypothalamic-pituitary-adrenal-gonadal axis. Acts as a coregulatory protein that inhibits the transcriptional activity of other nuclear receptors through heterodimeric interactions. May also have a role in the development of the embryo and in the maintenance of embryonic stem cell pluripotency (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear receptor subfamily 0 group B member 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ61066
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000053749 | 1-472 | Nuclear receptor subfamily 0 group B member 1 | |||
Sequence: MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQATEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCAKL |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in adult cerebral cortex, spinal cord, thymus, heart, lung, ovary, testis, adrenal gland, hypothalamus, spleen and kidney.
Developmental stage
Expressed at 5.5 dpc throughout the embryo except in the proximal visceral endoderm.
Gene expression databases
Interaction
Subunit
Homodimer. Interacts with NR5A1, NR5A2, NR0B2 and with COPS2 (By similarity).
Interacts with ESRRB; represses ESRRB activity at the GATA6 promoter (PubMed:27601327).
Interacts with ESRRB; represses ESRRB activity at the GATA6 promoter (PubMed:27601327).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q61066 | Esrrb Q61539 | 3 | EBI-2312665, EBI-2312731 | |
BINARY | Q61066 | Nanog Q80Z64 | 7 | EBI-2312665, EBI-2312517 | |
BINARY | Q61066 | Pou5f1 P20263 | 5 | EBI-2312665, EBI-1606219 | |
BINARY | Q61066 | Rif1 Q6PR54 | 2 | EBI-2312665, EBI-2312621 | |
BINARY | Q61066 | Slc8a1 P70414 | 2 | EBI-2312665, EBI-2312694 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for repeat, region, motif, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 1-67 | 1 | ||||
Sequence: MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQARSLLYRCC | ||||||
Region | 1-255 | 4 X 67 AA tandem repeats | ||||
Sequence: MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQARSLLYRCCFCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDASPGVQRLITLKDPQV | ||||||
Motif | 13-17 | LXXLL motif 1 | ||||
Sequence: LYNLL | ||||||
Repeat | 68-135 | 2 | ||||
Sequence: FCGENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGREGLPAGQAPSLLYRCC | ||||||
Motif | 80-84 | LXXLL motif 2 | ||||
Sequence: LYSML | ||||||
Repeat | 136-202 | 3 | ||||
Sequence: FCGEEHPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSY | ||||||
Motif | 148-152 | LXXLL motif 3 | ||||
Sequence: LYSLL | ||||||
Domain | 190-471 | NR LBD | ||||
Sequence: QSTQAMAFLYRSYVCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQILPLDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQATEQPQMVSAEAGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIEGLQWRTQQILTEHIRMMQREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCAK | ||||||
Repeat | 203-255 | 4; truncated | ||||
Sequence: VCGEEQPQQISVASGTPVSADQTPATPQEQPRAPWWDASPGVQRLITLKDPQV | ||||||
Compositional bias | 214-231 | Polar residues | ||||
Sequence: VASGTPVSADQTPATPQE | ||||||
Region | 214-238 | Disordered | ||||
Sequence: VASGTPVSADQTPATPQEQPRAPWW | ||||||
Region | 324-343 | Disordered | ||||
Sequence: TTRRQETEGPEPAEPQATEQ | ||||||
Motif | 463-468 | AF-2 motif | ||||
Sequence: MMLEML |
Domain
Homodimerization involved an interaction between amino and carboxy termini involving LXXLL motifs and steroid binding domain (AF-2 motif). Heterodimerizes with NR5A1 and NROB2 through its N-terminal LXXLL motifs (By similarity).
Sequence similarities
Belongs to the nuclear hormone receptor family. NR0 subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length472
- Mass (Da)52,576
- Last updated1996-11-01 v1
- ChecksumDE1FB01C30F883CF
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 214-231 | Polar residues | ||||
Sequence: VASGTPVSADQTPATPQE |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
S83180 EMBL· GenBank· DDBJ | AAB46875.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
S83178 EMBL· GenBank· DDBJ | AAB46875.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
U41568 EMBL· GenBank· DDBJ | AAC52920.1 EMBL· GenBank· DDBJ | mRNA |