Q60EZ2 · GSK2_ORYSJ
- ProteinShaggy-related protein kinase GSK2
- GeneGSK2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids402 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Serine-threonine kinase that acts as a negative regulator of brassinosteroid (BR) signaling (PubMed:22685166, PubMed:27332964, PubMed:30920691).
Phosphorylates DLT and BZR1, two positive regulators that mediates several BR responses. Phosphorylation of DLT and BZR1 inhibits their activities in BR signaling (PubMed:22685166).
Phosphorylates OFP8, a positive regulator of BR responses. Phosphorylated OFP8 shuttles from the nucleus to the cytoplasm where it is degraded by the proteasome (PubMed:27332964).
Phosphorylates the E3 ubiquitin-protein ligase PUB24, a negative regulator of BR signaling, which targets BZR1 and promotes its degradation via the 26S proteasome (PubMed:30920691).
Phosphorylation of PUB24 increases its stability (PubMed:30920691).
Phosphorylates the AP2-ERF transcription factor SMOS1, a positive regulator of BR signaling, which cooperatively functions in a transactivating complex with BZR1 to enhance the transcription of BR biosynthetic genes (PubMed:30920691).
Phosphorylation of SMOS1 leads to its degradation by an unknown mechanism (PubMed:30920691).
Phosphorylates DLT and BZR1, two positive regulators that mediates several BR responses. Phosphorylation of DLT and BZR1 inhibits their activities in BR signaling (PubMed:22685166).
Phosphorylates OFP8, a positive regulator of BR responses. Phosphorylated OFP8 shuttles from the nucleus to the cytoplasm where it is degraded by the proteasome (PubMed:27332964).
Phosphorylates the E3 ubiquitin-protein ligase PUB24, a negative regulator of BR signaling, which targets BZR1 and promotes its degradation via the 26S proteasome (PubMed:30920691).
Phosphorylation of PUB24 increases its stability (PubMed:30920691).
Phosphorylates the AP2-ERF transcription factor SMOS1, a positive regulator of BR signaling, which cooperatively functions in a transactivating complex with BZR1 to enhance the transcription of BR biosynthetic genes (PubMed:30920691).
Phosphorylation of SMOS1 leads to its degradation by an unknown mechanism (PubMed:30920691).
Miscellaneous
Plants over-expressing GSK2 display typical brassinosteroid (BR) loss-of-function phenotypes, and plants silencing GSK2 have enhanced BR signaling phenotypes.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Features
Showing features for binding site, active site.
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | protein kinase activity | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | brassinosteroid mediated signaling pathway | |
Biological Process | cell differentiation | |
Biological Process | negative regulation of brassinosteroid mediated signaling pathway |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameShaggy-related protein kinase GSK2
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ60EZ2
Proteomes
Genome annotation databases
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 284 | Gain-of-function mutant. | ||||
Sequence: T → I | ||||||
Mutagenesis | 286 | Gain-of-function mutant. | ||||
Sequence: E → K |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000439008 | 1-402 | Shaggy-related protein kinase GSK2 | |||
Sequence: MDQPAPAPEPMLLDAQPPAAVACDKKQQEGEAPYAEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLKHYSNANHRMPLIYVKLYMYQLFRGLAYIHTVPGVCHRDVKPQNVLVDPLTHQVKLCDFGSAKTLVPGEPNISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAHPFFDELREPNARLPNGRPFPPLFNFKHELANSSQELISRLIPEHVRRQATHNFFNTGS |
Post-translational modification
Autophosphorylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in lamina joints, vascular tissue and nodes.
Structure
Family & Domains
Features
Showing features for region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-38 | Disordered | ||||
Sequence: MDQPAPAPEPMLLDAQPPAAVACDKKQQEGEAPYAEGN | ||||||
Domain | 63-347 | Protein kinase | ||||
Sequence: YMAERVVGTGSFGIVFQAKCLETGETVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFSTTSRDELFLNLVMEYVPETLYRVLKHYSNANHRMPLIYVKLYMYQLFRGLAYIHTVPGVCHRDVKPQNVLVDPLTHQVKLCDFGSAKTLVPGEPNISYICSRYYRAPELIFGATEYTTSIDIWSAGCVLAELLLGQPLFPGESAVDQLVEIIKVLGTPTREEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAHPFF |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length402
- Mass (Da)45,509
- Last updated2004-11-23 v1
- ChecksumF92767F790691DAB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC104280 EMBL· GenBank· DDBJ | AAU90187.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008211 EMBL· GenBank· DDBJ | BAF16815.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014961 EMBL· GenBank· DDBJ | BAS92763.1 EMBL· GenBank· DDBJ | Genomic DNA |