Q60DW3 · ALFL5_ORYSJ
- ProteinPHD finger protein ALFIN-LIKE 5
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids258 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Histone-binding component that specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes.
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 218 | Histone H3K4me3 binding | ||||
Sequence: W | ||||||
Site | 222 | Histone H3K4me3 binding | ||||
Sequence: D | ||||||
Site | 227 | Histone H3K4me3 binding | ||||
Sequence: W |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | histone binding | |
Molecular Function | metal ion binding | |
Molecular Function | transcription cis-regulatory region binding | |
Molecular Function | transcription coregulator activity | |
Biological Process | chromatin organization | |
Biological Process | regulation of DNA-templated transcription |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended namePHD finger protein ALFIN-LIKE 5
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ60DW3
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000412945 | 1-258 | UniProt | PHD finger protein ALFIN-LIKE 5 | |||
Sequence: MDGGSGGPYTSRTAEEVFRDFRGRRAGMIKALTTDVEKFYQLCDPEKENLCLYGYPNETWEVTLPAEEVPPEIPEPALGINFARDGMNEKDWLALVAVHSDSWLLAVAFYFAARFGFDKEARRRLFNMINNLPTIFEVVTGAAKKQTKEKAPNSTNKPNKPSSKMQPRPESHSKAPKPPAPPKDDDESGDEYADEEEEERDNTLCGSCGTNDGKDEFWICCDSCERWYHGKCVKITPARAEHIKHYKCPDCGNKRARA | |||||||
Modified residue (large scale data) | 171 | PTMeXchange | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 188 | PTMeXchange | Phosphoserine | ||||
Sequence: S |
Proteomic databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 143-205 | Disordered | ||||
Sequence: AKKQTKEKAPNSTNKPNKPSSKMQPRPESHSKAPKPPAPPKDDDESGDEYADEEEEERDNTLC | ||||||
Compositional bias | 147-169 | Polar residues | ||||
Sequence: TKEKAPNSTNKPNKPSSKMQPRP | ||||||
Compositional bias | 187-201 | Acidic residues | ||||
Sequence: ESGDEYADEEEEERD | ||||||
Zinc finger | 202-254 | PHD-type | ||||
Sequence: NTLCGSCGTNDGKDEFWICCDSCERWYHGKCVKITPARAEHIKHYKCPDCGNK |
Domain
The PHD-type zinc finger mediates the binding to H3K4me3.
Sequence similarities
Belongs to the Alfin family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length258
- Mass (Da)29,105
- Last updated2004-11-23 v1
- ChecksumFF03F6E17727CF3E
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 147-169 | Polar residues | ||||
Sequence: TKEKAPNSTNKPNKPSSKMQPRP | ||||||
Compositional bias | 187-201 | Acidic residues | ||||
Sequence: ESGDEYADEEEEERD |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC137623 EMBL· GenBank· DDBJ | AAV25644.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008211 EMBL· GenBank· DDBJ | BAF17484.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP014961 EMBL· GenBank· DDBJ | BAS94060.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CM000142 EMBL· GenBank· DDBJ | EEE63756.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK121400 EMBL· GenBank· DDBJ | BAH00468.1 EMBL· GenBank· DDBJ | mRNA |