Q60809 · CNOT7_MOUSE
- ProteinCCR4-NOT transcription complex subunit 7
- GeneCnot7
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids285 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has 3'-5' poly(A) exoribonuclease activity for synthetic poly(A) RNA substrate. Its function seems to be partially redundant with that of CNOT8. Catalytic component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. During miRNA-mediated repression the complex seems also to act as translational repressor during translational initiation. Additional complex functions may be a consequence of its influence on mRNA expression. Required for miRNA-mediated mRNA deadenylation. Associates with members of the BTG family such as TOB1 and BTG2 and is required for their anti-proliferative activity.
Catalytic activity
Cofactor
Mg2+ (UniProtKB | Rhea| CHEBI:18420 )
Co2+ (UniProtKB | Rhea| CHEBI:48828 )
Note: Binds 2 divalent metal cations per subunit with RNAase activity being higher in presence of Mn2+ than of Mg2+ or Co2+.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 40 | a divalent metal cation 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 40 | a divalent metal cation 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 42 | a divalent metal cation 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: E | ||||||
Binding site | 161 | a divalent metal cation 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 230 | a divalent metal cation 2 (UniProtKB | ChEBI); catalytic | ||||
Sequence: D | ||||||
Binding site | 278 | a divalent metal cation 1 (UniProtKB | ChEBI); catalytic | ||||
Sequence: E |
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCCR4-NOT transcription complex subunit 7
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ60809
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: NANOS2 promotes its localization to P-body (PubMed:20133598).
Recruited to cytoplasmic ribonucleoprotein membraneless compartments by CAPRIN1, promoting deadenylation of mRNAs (By similarity).
Recruited to cytoplasmic ribonucleoprotein membraneless compartments by CAPRIN1, promoting deadenylation of mRNAs (By similarity).
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 203 | Severe decrease of interaction with BTG4. | ||||
Sequence: K → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 5 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000212845 | 1-285 | CCR4-NOT transcription complex subunit 7 | |||
Sequence: MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEASKQS |
Proteomic databases
PTM databases
Expression
Developmental stage
Expressed in embryonic stem (ES) cells.
Gene expression databases
Interaction
Subunit
Component of the CCR4-NOT complex; distinct complexes seem to exist that differ in the participation of probably mutually exclusive catalytic subunits; the complex contains two deadenylase subunits, CNOT6 or CNOT6L, and CNOT7 or CNOT8 (By similarity).
In the complex, interacts directly with CNOT1 (By similarity).
Interacts with AGO2 (PubMed:19716330).
Interacts with TOB1; recruited by TOB1 to a ternary complex with CPEB3 which is required for mRNA deadenylation and decay (By similarity).
Interacts with BTG1 (PubMed:9712883).
Interacts with BTG2 (PubMed:9712883).
Interacts with NANOS2 (PubMed:20133598).
Interacts with ZFP36, ZFP36L1 and ZFP36L2; these interactions are inhibited in response to phorbol 12-myristate 13-acetate (PMA) treatment in a p38 MAPK-dependent manner (By similarity).
Interacts with BTG4 (PubMed:27065194).
Interacts with EIF4E; this interaction is increased by CNOT7 interaction with BTG4 (PubMed:27065194).
In the complex, interacts directly with CNOT1 (By similarity).
Interacts with AGO2 (PubMed:19716330).
Interacts with TOB1; recruited by TOB1 to a ternary complex with CPEB3 which is required for mRNA deadenylation and decay (By similarity).
Interacts with BTG1 (PubMed:9712883).
Interacts with BTG2 (PubMed:9712883).
Interacts with NANOS2 (PubMed:20133598).
Interacts with ZFP36, ZFP36L1 and ZFP36L2; these interactions are inhibited in response to phorbol 12-myristate 13-acetate (PMA) treatment in a p38 MAPK-dependent manner (By similarity).
Interacts with BTG4 (PubMed:27065194).
Interacts with EIF4E; this interaction is increased by CNOT7 interaction with BTG4 (PubMed:27065194).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | Q60809 | BTG1 P62324 | 5 | EBI-2104739, EBI-742279 | |
BINARY | Q60809 | Btg2 Q04211 | 2 | EBI-2104739, EBI-7847081 | |
XENO | Q60809 | BTG2 P78543 | 5 | EBI-2104739, EBI-1047576 | |
BINARY | Q60809 | Btg4 O70552 | 6 | EBI-2104739, EBI-16204405 | |
XENO | Q60809 | CNOT11 Q9UKZ1 | 3 | EBI-2104739, EBI-2562014 | |
BINARY | Q60809 | Cnot6l Q8VEG6 | 2 | EBI-2104739, EBI-2104661 | |
XENO | Q60809 | EIF4E P06730 | 2 | EBI-2104739, EBI-73440 | |
XENO | Q60809 | TOB2 Q14106 | 4 | EBI-2104739, EBI-2562000 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length285
- Mass (Da)32,718
- Last updated1996-11-01 v1
- Checksum2AF23EC38E06EFDB
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q3TLK9 | Q3TLK9_MOUSE | Cnot7 | 248 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U21855 EMBL· GenBank· DDBJ | AAA87455.1 EMBL· GenBank· DDBJ | mRNA | ||
BC006021 EMBL· GenBank· DDBJ | AAH06021.1 EMBL· GenBank· DDBJ | mRNA |