Q60771 · CLD11_MOUSE
- ProteinClaudin-11
- GeneCldn11
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids207 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | basal part of cell | |
Cellular Component | bicellular tight junction | |
Cellular Component | lipid droplet | |
Cellular Component | myelin sheath | |
Cellular Component | neurofilament | |
Cellular Component | plasma membrane | |
Cellular Component | tight junction | |
Molecular Function | identical protein binding | |
Molecular Function | structural molecule activity | |
Biological Process | axon ensheathment | |
Biological Process | bicellular tight junction assembly | |
Biological Process | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules | |
Biological Process | cell adhesion | |
Biological Process | spermatogenesis |
Names & Taxonomy
Protein names
- Recommended nameClaudin-11
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ60771
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1 | Cytoplasmic | ||||
Sequence: M | ||||||
Transmembrane | 2-22 | Helical | ||||
Sequence: VATCLQVVGFVTSFVGWIGII | ||||||
Topological domain | 23-82 | Extracellular | ||||
Sequence: VTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACR | ||||||
Transmembrane | 83-103 | Helical | ||||
Sequence: ALMIAASVLGLPAILLLLTVL | ||||||
Topological domain | 104-122 | Cytoplasmic | ||||
Sequence: PCIRMGHEPGVAKYRRAQL | ||||||
Transmembrane | 123-143 | Helical | ||||
Sequence: AGVLLILLALCAIVATIWFPV | ||||||
Topological domain | 144-157 | Extracellular | ||||
Sequence: CAHREITIVSFGYS | ||||||
Transmembrane | 158-178 | Helical | ||||
Sequence: LYAGWIGAVMCLVGGCVIVCC | ||||||
Topological domain | 179-207 | Cytoplasmic | ||||
Sequence: SGDAQSFGENRFYYSSGSSSPTHAKSAHV |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000144762 | 1-207 | Claudin-11 | |||
Sequence: MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCSYTIPTCRKMDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGHEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHREITIVSFGYSLYAGWIGAVMCLVGGCVIVCCSGDAQSFGENRFYYSSGSSSPTHAKSAHV | ||||||
Modified residue | 193 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 194 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 197 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 198 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with tetraspanin-3/TSPAN3 (PubMed:11309411).
Interacts with OCLN (By similarity).
Interacts with OCLN (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q60771 | Csf1 P07141 | 2 | EBI-309095, EBI-777188 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length207
- Mass (Da)22,114
- Last updated1996-11-01 v1
- ChecksumA3F936F15958F27B
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 196 | in Ref. 3; BAB23860 | ||||
Sequence: S → C |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U19582 EMBL· GenBank· DDBJ | AAB50270.1 EMBL· GenBank· DDBJ | mRNA | ||
AF124426 EMBL· GenBank· DDBJ | AAD17321.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005088 EMBL· GenBank· DDBJ | BAB23810.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005171 EMBL· GenBank· DDBJ | BAB23860.1 EMBL· GenBank· DDBJ | mRNA | ||
AK161698 EMBL· GenBank· DDBJ | BAE36538.1 EMBL· GenBank· DDBJ | mRNA | ||
BC021659 EMBL· GenBank· DDBJ | AAH21659.1 EMBL· GenBank· DDBJ | mRNA |