Q60411 · ADAM2_CAVPO
- ProteinDisintegrin and metalloproteinase domain-containing protein 2
- GeneADAM2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids735 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | plasma membrane | |
Molecular Function | metalloendopeptidase activity | |
Biological Process | binding of sperm to zona pellucida | |
Biological Process | cell adhesion | |
Biological Process | male gonad development | |
Biological Process | proteolysis |
Keywords
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameDisintegrin and metalloproteinase domain-containing protein 2
- Short namesADAM 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Hystricomorpha > Caviidae > Cavia
Accessions
- Primary accessionQ60411
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Membrane ; Single-pass type I membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 16-680 | Extracellular | ||||
Sequence: GPLKKYVENSGMQITVPEKIRSVKRGSVESEVSYKIVIENTTYIVNLVRKMFLPHDFQVYSYDSAGIMKPFEDYSQNFCYYQGHIEGFPTSLASISTCAGLRGLLQFETVSYGIEPLKSSIGFEHVIYPVKHDNEKSQYLKKSINVKNVVYKIKSIKSSVRTHYIEMHIIVEKNLYKHMGGNTATVTEKIFQLVGLMNAFFSTLNLTVILASLELWIDENKIPTTGDVNELLHAFQKWKKSYLVLRPHDVAFLLVYRESPSYIGAIFQGMICNTSYGGGIALHSKTITLDSFGVILVQLLSVSMGIAYDNADLCRCRGAICLMSPEAVFSSGMKMFSNCSVKAFKLFTSSQVSQCLQNQPYLEPVYRSNPVCGNNRVEQGEDCDCGSQEECQDTCCDAATCRLKSTSRCAQGPCCNQCEFKTKGEVCRESTDECDLPEYCNGSSGACQEDLYVINGHRCANEEWICMNGRCLSGKAQVQETFGTEMEMGSVDCFEQLNTKNDITGNCGILSPGNYKACGASNWKCGKLICSYDKSEILRNKEGMTIYANISGHICVSIEYPPGHAKSALMWVRDGTVCGPSEVCRQQQCVSSSYLGYDCTPATCSDHGVCNNKRHCHCNPTYVPPNCETQDSTKPGGSVDSGNLRYEPIPETYFVEGAYHTKSRK | ||||||
Transmembrane | 681-701 | Helical | ||||
Sequence: WPFFLIIPFFVIFSVLVATVV | ||||||
Topological domain | 702-735 | Cytoplasmic | ||||
Sequence: KVYYQKKKWKTEDYANDENIESESEPKSSKVSSK |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, propeptide, glycosylation, chain, disulfide bond, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-15 | |||||
Sequence: MLCLLLLLCGLASLG | ||||||
Propeptide | PRO_0000029040 | 16-176 | ||||
Sequence: GPLKKYVENSGMQITVPEKIRSVKRGSVESEVSYKIVIENTTYIVNLVRKMFLPHDFQVYSYDSAGIMKPFEDYSQNFCYYQGHIEGFPTSLASISTCAGLRGLLQFETVSYGIEPLKSSIGFEHVIYPVKHDNEKSQYLKKSINVKNVVYKIKSIKSSVR | ||||||
Glycosylation | 55 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Chain | PRO_0000029041 | 177-735 | Disintegrin and metalloproteinase domain-containing protein 2 | |||
Sequence: THYIEMHIIVEKNLYKHMGGNTATVTEKIFQLVGLMNAFFSTLNLTVILASLELWIDENKIPTTGDVNELLHAFQKWKKSYLVLRPHDVAFLLVYRESPSYIGAIFQGMICNTSYGGGIALHSKTITLDSFGVILVQLLSVSMGIAYDNADLCRCRGAICLMSPEAVFSSGMKMFSNCSVKAFKLFTSSQVSQCLQNQPYLEPVYRSNPVCGNNRVEQGEDCDCGSQEECQDTCCDAATCRLKSTSRCAQGPCCNQCEFKTKGEVCRESTDECDLPEYCNGSSGACQEDLYVINGHRCANEEWICMNGRCLSGKAQVQETFGTEMEMGSVDCFEQLNTKNDITGNCGILSPGNYKACGASNWKCGKLICSYDKSEILRNKEGMTIYANISGHICVSIEYPPGHAKSALMWVRDGTVCGPSEVCRQQQCVSSSYLGYDCTPATCSDHGVCNNKRHCHCNPTYVPPNCETQDSTKPGGSVDSGNLRYEPIPETYFVEGAYHTKSRKWPFFLIIPFFVIFSVLVATVVKVYYQKKKWKTEDYANDENIESESEPKSSKVSSK | ||||||
Glycosylation | 220 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 287↔370 | |||||
Sequence: CNTSYGGGIALHSKTITLDSFGVILVQLLSVSMGIAYDNADLCRCRGAICLMSPEAVFSSGMKMFSNCSVKAFKLFTSSQVSQC | ||||||
Glycosylation | 288 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 329↔354 | |||||
Sequence: CRCRGAICLMSPEAVFSSGMKMFSNC | ||||||
Disulfide bond | 331↔336 | |||||
Sequence: CRGAIC | ||||||
Glycosylation | 353 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 442↔455 | |||||
Sequence: CRESTDECDLPEYC | ||||||
Glycosylation | 456 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 564 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 614↔625 | |||||
Sequence: CTPATCSDHGVC | ||||||
Disulfide bond | 619↔631 | |||||
Sequence: CSDHGVCNNKRHC | ||||||
Disulfide bond | 633↔642 | |||||
Sequence: CNPTYVPPNC | ||||||
Modified residue | 723 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
The signal and the metalloprotease domain are cleaved during the epididymal maturation of the spermatozoa.
Keywords
- PTM
PTM databases
Expression
Tissue specificity
Expressed specifically in testis.
Developmental stage
Expression begins during meiotic prophase.
Interaction
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 178-375 | Peptidase M12B | ||||
Sequence: HYIEMHIIVEKNLYKHMGGNTATVTEKIFQLVGLMNAFFSTLNLTVILASLELWIDENKIPTTGDVNELLHAFQKWKKSYLVLRPHDVAFLLVYRESPSYIGAIFQGMICNTSYGGGIALHSKTITLDSFGVILVQLLSVSMGIAYDNADLCRCRGAICLMSPEAVFSSGMKMFSNCSVKAFKLFTSSQVSQCLQNQP | ||||||
Domain | 384-470 | Disintegrin | ||||
Sequence: NPVCGNNRVEQGEDCDCGSQEECQDTCCDAATCRLKSTSRCAQGPCCNQCEFKTKGEVCRESTDECDLPEYCNGSSGACQEDLYVIN | ||||||
Domain | 610-643 | EGF-like | ||||
Sequence: LGYDCTPATCSDHGVCNNKRHCHCNPTYVPPNCE | ||||||
Region | 716-735 | Disordered | ||||
Sequence: ANDENIESESEPKSSKVSSK |
Domain
A tripeptide motif (TDE) within disintegrin-like domain could be involved in the binding to egg integrin receptor and thus could mediate sperm/egg binding.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length735
- Mass (Da)81,905
- Last updated1996-11-01 v1
- Checksum7535FC39F44FB645
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Z11720 EMBL· GenBank· DDBJ | CAA77784.1 EMBL· GenBank· DDBJ | mRNA |