Q5Z8R1 · IPI1_ORYSJ
- ProteinE3 ubiquitin-protein ligase IPI1
- GeneIPI1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids455 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Functions as an E3 ligase that promotes polyubiquitination of SPL14/IPA1 for subsequent proteasomal degradation (PubMed:28298520).
Regulates plant architecture by modulating SPL14/IPA1 abundance (PubMed:28298520).
Promotes the degradation of SPL14/IPA1 in panicles, while it stabilizes SPL14/IPA1 in shoot apices (PubMed:28298520).
Ubiquitinates the SPL14/IPA1-mediated complex with 'Lys-48'-linked polyubiquitin in panicles and 'Lys-63'-linked polyubiquitin chains in the shoot apex (PubMed:28298520).
Regulates plant architecture by modulating SPL14/IPA1 abundance (PubMed:28298520).
Promotes the degradation of SPL14/IPA1 in panicles, while it stabilizes SPL14/IPA1 in shoot apices (PubMed:28298520).
Ubiquitinates the SPL14/IPA1-mediated complex with 'Lys-48'-linked polyubiquitin in panicles and 'Lys-63'-linked polyubiquitin chains in the shoot apex (PubMed:28298520).
Catalytic activity
Pathway
Protein modification; protein ubiquitination.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Molecular Function | ubiquitin-protein transferase activity | |
Biological Process | floral organ structural organization | |
Biological Process | protein ubiquitination | |
Biological Process | regulation of seed development |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase IPI1
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ5Z8R1
- Secondary accessions
Proteomes
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Altered plant architecture, including increased number of tillers, enlarged panicles, and increased grain yield per plant.
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 74 | Loss of E3 ubiquitin-protein ligase activity. | ||||
Sequence: H → Y | ||||||
Mutagenesis | 80 | Loss of E3 ubiquitin-protein ligase activity. | ||||
Sequence: C → S |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000453486 | 1-455 | E3 ubiquitin-protein ligase IPI1 | |||
Sequence: MGAEEEEEPASAVGREGGGGGGGARAAGAGAGGDTADDDDSGESAAAVVPCSICLDAVVAGGGDRSTARLQCGHEFHLDCIGSAFNAKGVMQCPNCRQIERGNWLYANGSRPSQDVSNDDWGHDEDFYDANQPETSRSVFLPFRFQWCPIGRLAQLPSVFDEGESAPPVTFHDFMGQNFTSEHLPVSAPGATPPGPYIAYFQPLQSSASSSSSHVTERTMDGTTYHDHWNPLPGPSDGRPLATVHPIDFHHNHWTHLPNSYSQPNSNNGVAEQMAIPVVPMRVGGLDSDSQQRGSLPSVYGNGSGSRSRIPSVPPMAPQFMRPHGNINEQYQQNSSSLYAAPQRRTAVQAVQDSMNFTLFPQAPTGPNSMETEDAGGNQFYAWERDRFAPYPLMPVDSEANWWGSTPQSHGVTDHSAAPGRRLFGQWIGAGRSPPPPPPPPADNSSYRQMHIPRM |
Proteomic databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with SPL14/IPA1.
Structure
Family & Domains
Features
Showing features for region, zinc finger, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-42 | Disordered | ||||
Sequence: MGAEEEEEPASAVGREGGGGGGGARAAGAGAGGDTADDDDSG | ||||||
Zinc finger | 51-97 | RING-type; atypical | ||||
Sequence: CSICLDAVVAGGGDRSTARLQCGHEFHLDCIGSAFNAKGVMQCPNCR | ||||||
Region | 286-311 | Disordered | ||||
Sequence: LDSDSQQRGSLPSVYGNGSGSRSRIP | ||||||
Compositional bias | 288-309 | Polar residues | ||||
Sequence: SDSQQRGSLPSVYGNGSGSRSR | ||||||
Region | 426-455 | Disordered | ||||
Sequence: QWIGAGRSPPPPPPPPADNSSYRQMHIPRM |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q5Z8R1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length455
- Mass (Da)48,894
- Last updated2004-11-23 v1
- Checksum31ECDF03DAD6ECBD
Q5Z8R1-2
- Name2
- Differences from canonical
- 304-455: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0V2B1 | A0A0P0V2B1_ORYSJ | Os01g0350900 | 341 |
Sequence caution
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 288-309 | Polar residues | ||||
Sequence: SDSQQRGSLPSVYGNGSGSRSR | ||||||
Alternative sequence | VSP_061157 | 304-455 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AP003258 EMBL· GenBank· DDBJ | BAD52927.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP003764 EMBL· GenBank· DDBJ | BAD53853.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AP008207 EMBL· GenBank· DDBJ | BAF04896.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AP014957 EMBL· GenBank· DDBJ | BAS72030.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AK070217 EMBL· GenBank· DDBJ | BAG91836.1 EMBL· GenBank· DDBJ | mRNA |