Q5XIN1 · MDM4_RAT
- ProteinProtein Mdm4
- GeneMdm4
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids490 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein Mdm4
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5XIN1
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000331516 | 1-490 | Protein Mdm4 | |||
Sequence: MTSHSTSAQCSASDSACRISSEQINQQVRPKLQLLKILQAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHLVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVTSASVNTDAAQTLALAQDHTMDIPSQDRLKHGATECSNPRKRTEEDDTHTLPTSRRKCRDSRADEDLIEHLSQDETSRLDLDFEEWDVAGLPWWFLGNLRNNYIPRSNGSTDLQTNQDIGTAIVSDTTDDLWFLNETVSEQLGVGVKVEAANCEQPSEVGRTRDKKMVEGGKDDDLEDSKSLSDDTDVEVTSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSNITAIPEKKDNEGIDVPDCRRTISAPVVRPKDGYLKEEKPRFDPCNSVEFLDLAHGSESQEIISSTREQTDIFSEQKTETESMEDFQNVLKPCSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACKKEIQLVIKVFIA | ||||||
Modified residue | 180 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 342 | Phosphoserine; by CHEK2 | ||||
Sequence: S | ||||||
Modified residue | 368 | Phosphoserine; by CHEK1 and CHEK2 | ||||
Sequence: S |
Post-translational modification
Phosphorylated. Phosphorylation at Ser-368 promotes interaction with YWHAG and subsequent ubiquitination and degradation. Phosphorylation at Ser-342 also induces ubiquitination and degradation but to a lower extent (By similarity).
Ubiquitinated and degraded by MDM2. Deubiquitination by USP2 on the other hand stabilizes the MDM4 protein (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Interacts with MDM2, TP53, TP73 and USP2. Found in a trimeric complex with USP2, MDM2 and MDM4. Interacts (phosphorylated) with YWHAG; negatively regulates MDM4 activity toward TP53 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, zinc finger, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 26-109 | SWIB/MDM2 | ||||
Sequence: QQVRPKLQLLKILQAAGAQGEVFTMKEVMHYLGQYIMVKQLYDQQEQHLVYCGGDLLGDLLGCQSFSVKDPSPLYDMLRKNLVT | ||||||
Region | 136-162 | Disordered | ||||
Sequence: RLKHGATECSNPRKRTEEDDTHTLPTS | ||||||
Region | 263-294 | Disordered | ||||
Sequence: QPSEVGRTRDKKMVEGGKDDDLEDSKSLSDDT | ||||||
Compositional bias | 266-294 | Basic and acidic residues | ||||
Sequence: EVGRTRDKKMVEGGKDDDLEDSKSLSDDT | ||||||
Zinc finger | 300-329 | RanBP2-type | ||||
Sequence: SEDEWQCTECKKFNSPSKRYCFRCWALRKD | ||||||
Region | 393-490 | Necessary for interaction with USP2 | ||||
Sequence: EFLDLAHGSESQEIISSTREQTDIFSEQKTETESMEDFQNVLKPCSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACKKEIQLVIKVFIA | ||||||
Zinc finger | 437-478 | RING-type; degenerate | ||||
Sequence: CSLCEKRPRDGNIIHGKTSHLTTCFHCARRLKKSGASCPACK | ||||||
Motif | 442-445 | Nuclear localization signal | ||||
Sequence: KRPR |
Sequence similarities
Belongs to the MDM2/MDM4 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length490
- Mass (Da)55,221
- Last updated2004-11-23 v1
- Checksum7286E5E024E8AAE0
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8L2Q5T6 | A0A8L2Q5T6_RAT | Mdm4 | 490 | ||
A0A8I6A2G0 | A0A8I6A2G0_RAT | Mdm4 | 441 | ||
A0A8I5ZK52 | A0A8I5ZK52_RAT | Mdm4 | 319 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 266-294 | Basic and acidic residues | ||||
Sequence: EVGRTRDKKMVEGGKDDDLEDSKSLSDDT |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BC083647 EMBL· GenBank· DDBJ | AAH83647.1 EMBL· GenBank· DDBJ | mRNA |