Q5XG71 · UTP20_MOUSE
- ProteinSmall subunit processome component 20 homolog
- GeneUtp20
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids2788 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome. Involved in 18S pre-rRNA processing. Associates with U3 snoRNA.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | 90S preribosome | |
Cellular Component | nucleolus | |
Cellular Component | small-subunit processome | |
Biological Process | ribosomal small subunit biogenesis | |
Biological Process | rRNA processing |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSmall subunit processome component 20 homolog
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionQ5XG71
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Colocalizes with NCL in the nucleolus.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000080012 | 1-2788 | Small subunit processome component 20 homolog | |||
Sequence: MKPKPLSHKTENTYRFLTFAERLGNVNIDIIHRIDRTASYDEDVETYFFEALLKWRELNLTEHFGKFYKEVIDKCQSFNQLVYHQNEIVQSLKTHLQIRNSLAYQPLLDLVVQLARDLQTDFYPHFEDFFLTITSILETQDTELLEWAFTSLSYLYKYLWRLMVKDMSKIYSLYSTLLAHKKLHIRNFAAESFTFLMRKVSDKNALFNLMFLDLNEHPEKVEGVGQLLFEMCKGVRNMFHSCTGQALKLLLQKLGPVTETETQLPWILVGETLKTMAKSSVVYIYKEHFGVFFDCLQESLLELHNKVTEANCCENSEQMRRLLETYLIVVKHGSGSKITRPADVCGVLSEALQTASLSTSCRKTLLDVVSALLLAENVSLPETLIKETVEKVFESKFERRSVLDFSEVMFAMKQFEQLFLPSFLLYIENCFLMDNSVVSDEALAILAKLILHKAPPPTAGSMAIEKYPLVFSQQTVGSYLKQRKADSKRRKEQFPVLSHLLSIVQLPPNKDATYLSRSWAALVVLPHLRPLEKEKTISLVSCFIESLFLAVDRGSFGKGHLFVLCQAVNTLLSLEESSELLHLVPVGRVKHLVLTSPTEPSVLLLADLYYQRLALCGCKGPLSEEALMELFPKLQANISTGVSKIRLLTIRILNHFDIRLPVSMEDDGLSERQSAFAILRQAELVPATVSDYREKLLHLRKLRHDVVQGAVPQGRLQEVPLRYLLGMLYVNFSALWDPVIELISSHAYGMENKQFWNVCYEHLEKAASHAEKELHKDVRDEESTGDESWEQTQEGDVGDLYQQQLALKTDCRERLDHTNFRFLLWRALAKFPERVEPRSRELSPLFLRFINNEYYPADLQVAPTQDLRKKGRGAVAEEEEEEEPAAGEDEELEEEAVPTEDAPQKKKTRRAAAKQLIAHLQVFSKFSNPRALYLESKLYELYLQLLLHQDQAVQKITLDCIMTYRHPHILPYRENLQRLLDDRSFKEEIVHFNISEDNTVVKAAHRADLFPILMRILYGRMKNKTGSKTQGKSASGTRMAIVLRFLAGTQPEEIQLFLDLLSEPVKHFKDGDCCSAVIQAVEDLDVSKVLPVGRQHGVLNSLEVVLKNISHLISTYLPKILQILLCMTATVSHILDQREKIQLRFINPLKNLRRLGIKMVTDIFLDWESYQFKAEEIDAVFHGTVWPQICRLGSESQYSPTPLLKLISIWSRNARYFPLLAKQKPGHPEYDILTNVFAVLSAKNLSEATASIIMDIVDDLLNLPDFQPTEAVPSLPVTGCVYADVAEDTEPVTVGGRLVLPHVPAILQYLSKTTISAEKVKKKKNRAQVSKELGILSKISKFMKDREQCSLLITLLLPFLLRGNVAQDTELDILVTVQNLLQHCLHPAHFLRPLAKLFSVIKNKLSRQLLCTVFQMSDFESRLKYITDIVKLNAFDKRHLDDINFDVRFSAFQTITSNIKAMQTVDADYLIAVMHNCFYNMEIGDMSLSDNASICLTSIIKRLAALNVTEKEYKEIIHRTLLEKLRKGLKSQTESVQHDYTLILSCLIQTFPNQLEFKDLVQLTHCHDPEMDFFENMKHIQIHRRARALKKLAKQLLEGQVVLSSKSLQNYIMPYAMAPILDEKMLKHENITIAATEVIGAICRHLSWPAYVYYLKHFIHVLQSGQINQKLAVSLLVIVLEAFHFDYKTLEEQMGNVKNEENTVEMAELLEPEAMEVEDMDEAGKEQASERLSDSKEALGAPEAAASEGTVAKEQECISKSVSFLPRNKEELERTIQTIQGAITGDILPRLHKCLASATKREEEHKLVKSKVVNDEEVVRVPLAFAMVKLMRSLPREVMEANLPSILLKVCVLLKNRAQEIRDIARSTLSKIIEDLGVHFLQYVLKELQTTLVRGYQVHVLTFTVYTLLQGLSSKLQVGDLDSCLHIMTEIFNHELFGALAEEKEVKQILSKVMEARRSKSYDSYEILGKFVGKQQVTKLILPLKEILQNTTSLKLARKVHETLRRIIAGLIVNPDMTADALLLLSYGLVSENLPLLTEKEKKPAAPVPDARLPPQSCLLLPATPVRGGPKAVVNKKTNMHIFIESGLRLLHLSLKTSRIKSSSEHVLEMLDPFVSVLINCLGAQDVKVITGALQCLIWVLRFPLPSIASKAEQLTKHLFLLLKNYARVGAARGQNFHLVVNCFKCVTIVVKKVKSHQITEKQLQVLLAYAEEDIYDTSRQATAFGLLKAILSRKLLVPEIDDIMRKVSKLAISAQNEPARVQCRQVFLKYILDYPLGEKLRPNLEFMLAQLNYEHETGRESTLEMIAYLFETFPQGLLHEHCGMFFIPLCLMMVNDDSAMCKRMASMAIKSLLSKVDREKKDWLFGLVTSWFEAKKRLNRQLAALACGLFVESEGVDFERRLGTLLPVIEKEIDPENFKDIIEETEEKAADRLLFGFLTLMRKLIKECSIIHFTKPSETLSKIWSHVHSHLRHPHSWVWLTAAQIFGLLFASCQPEELIQKWKGKKTKKKTSDPIAVRFLTSDLGQKMKSISLASCHQLHSKFLDESLGEQVVKNLLFIAKVLYLLELESGNKRGEVKDSEEQDTLADALAREAAEEKAGAGGKMESNREKKEEPSKPATLMWLIQKLSRMAKLEAAYSPRNPLKRTCIFKFLGAVAVDLGVDRVKPYLPLIIAPLFRELNSTFAEQDPVLKNLSQEIIELLKKLVGLESFSLAFASVQKQASEKRALRKKRKALEFVTNPDIAAKKKLKKHKNKSEAKKRKIEFLRPGYKAKRQKSHSLRDLAMVE | ||||||
Modified residue | 788 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 2640 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Family & Domains
Features
Showing features for repeat, compositional bias, region, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 165-202 | HEAT 1 | ||||
Sequence: KDMSKIYSLYSTLLAHKKLHIRNFAAESFTFLMRKVSD | ||||||
Compositional bias | 771-786 | Basic and acidic residues | ||||
Sequence: EKELHKDVRDEESTGD | ||||||
Region | 771-795 | Disordered | ||||
Sequence: EKELHKDVRDEESTGDESWEQTQEG | ||||||
Region | 866-908 | Disordered | ||||
Sequence: DLRKKGRGAVAEEEEEEEPAAGEDEELEEEAVPTEDAPQKKKT | ||||||
Compositional bias | 878-897 | Acidic residues | ||||
Sequence: EEEEEEPAAGEDEELEEEAV | ||||||
Region | 1718-1752 | Disordered | ||||
Sequence: EDMDEAGKEQASERLSDSKEALGAPEAAASEGTVA | ||||||
Compositional bias | 1721-1737 | Basic and acidic residues | ||||
Sequence: DEAGKEQASERLSDSKE | ||||||
Repeat | 1841-1878 | HEAT 2 | ||||
Sequence: ANLPSILLKVCVLLKNRAQEIRDIARSTLSKIIEDLGV | ||||||
Region | 2598-2617 | Disordered | ||||
Sequence: EKAGAGGKMESNREKKEEPS | ||||||
Coiled coil | 2691-2768 | |||||
Sequence: VLKNLSQEIIELLKKLVGLESFSLAFASVQKQASEKRALRKKRKALEFVTNPDIAAKKKLKKHKNKSEAKKRKIEFLR |
Sequence similarities
Belongs to the UTP20 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length2,788
- Mass (Da)317,744
- Last updated2005-04-12 v2
- Checksum258424B5802D4636
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1W2P6J9 | A0A1W2P6J9_MOUSE | Utp20 | 162 | ||
A0A1W2P7L8 | A0A1W2P7L8_MOUSE | Utp20 | 201 | ||
A0A1W2P8D7 | A0A1W2P8D7_MOUSE | Utp20 | 141 | ||
E9QK83 | E9QK83_MOUSE | Utp20 | 2789 |
Sequence caution
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 771-786 | Basic and acidic residues | ||||
Sequence: EKELHKDVRDEESTGD | ||||||
Compositional bias | 878-897 | Acidic residues | ||||
Sequence: EEEEEEPAAGEDEELEEEAV | ||||||
Compositional bias | 1721-1737 | Basic and acidic residues | ||||
Sequence: DEAGKEQASERLSDSKE | ||||||
Sequence conflict | 1883 | in Ref. 3; BAC53793 | ||||
Sequence: Y → C | ||||||
Sequence conflict | 2190 | in Ref. 3; BAC53793 | ||||
Sequence: V → R | ||||||
Sequence conflict | 2397 | in Ref. 2; AAH05522 | ||||
Sequence: V → L | ||||||
Sequence conflict | 2472 | in Ref. 4; BAC32954 | ||||
Sequence: L → V |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC155820 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC164567 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC005522 EMBL· GenBank· DDBJ | AAH05522.1 EMBL· GenBank· DDBJ | mRNA | ||
BC048955 EMBL· GenBank· DDBJ | AAH48955.1 EMBL· GenBank· DDBJ | mRNA | ||
BC084586 EMBL· GenBank· DDBJ | AAH84586.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AB052760 EMBL· GenBank· DDBJ | BAC53793.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
AK047081 EMBL· GenBank· DDBJ | BAC32954.2 EMBL· GenBank· DDBJ | mRNA |