Q5VY09 · IER5_HUMAN
- ProteinImmediate early response gene 5 protein
- GeneIER5
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids327 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role as a transcription factor (PubMed:22132193, PubMed:25355627).
Mediates positive transcriptional regulation of several chaperone genes during the heat shock response in a HSF1-dependent manner (PubMed:25355627, PubMed:25816751).
Mediates negative transcriptional regulation of CDC25B expression (PubMed:22132193).
Plays a role in the dephosphorylation of the heat shock factor HSF1 and ribosomal protein S6 kinase (S6K) by the protein phosphatase PP2A (PubMed:25816751, PubMed:26496226).
Involved in the regulation of cell proliferation and resistance to thermal stress (PubMed:22132193, PubMed:25355627, PubMed:26496226).
Involved in the cell cycle checkpoint and survival in response to ionizing radiation (PubMed:19238419, PubMed:22132193).
Associates with chromatin to the CDC25B promoter (PubMed:22132193).
Mediates positive transcriptional regulation of several chaperone genes during the heat shock response in a HSF1-dependent manner (PubMed:25355627, PubMed:25816751).
Mediates negative transcriptional regulation of CDC25B expression (PubMed:22132193).
Plays a role in the dephosphorylation of the heat shock factor HSF1 and ribosomal protein S6 kinase (S6K) by the protein phosphatase PP2A (PubMed:25816751, PubMed:26496226).
Involved in the regulation of cell proliferation and resistance to thermal stress (PubMed:22132193, PubMed:25355627, PubMed:26496226).
Involved in the cell cycle checkpoint and survival in response to ionizing radiation (PubMed:19238419, PubMed:22132193).
Associates with chromatin to the CDC25B promoter (PubMed:22132193).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleolus | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | identical protein binding | |
Biological Process | cellular response to heat | |
Biological Process | positive regulation of cellular response to heat | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of cell population proliferation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameImmediate early response gene 5 protein
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5VY09
- Secondary accessions
Proteomes
Organism-specific databases
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_028404 | 92 | in dbSNP:rs3747955 | |||
Sequence: R → H | ||||||
Natural variant | VAR_028405 | 168 | in dbSNP:rs3747954 | |||
Sequence: V → I | ||||||
Natural variant | VAR_028406 | 194 | in dbSNP:rs1416829 | |||
Sequence: R → G | ||||||
Natural variant | VAR_028407 | 202 | in dbSNP:rs1361365 | |||
Sequence: Q → R | ||||||
Natural variant | VAR_028408 | 285 | in dbSNP:rs3747951 | |||
Sequence: P → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 465 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000190438 | 1-327 | Immediate early response gene 5 protein | |||
Sequence: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSDPCPGLYLAGPAGTPAPPPQQQPGEPAAGPPAGWGEPPPPAARASWPETEPQPERSSVSDAPRVGDEVPVATVTGVGDVFQGGEADATEAAWSRVEGPRQAAAREAEGTAGGWGVFPEVSRAARRPCGCPLGGEDPPGTPAATPRAACCCAPQPAEDEPPAPPAVCPRKRCAAGVGGGPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPVLRDMNPWSTAIVAF |
Proteomic databases
PTM databases
Interaction
Subunit
Monomer (PubMed:26496226).
Homodimer (PubMed:26496226).
Associates with the catalytic subunit of protein phosphatase PP2A (PubMed:25816751, PubMed:26496226).
Interacts (via N- and C-terminal regions) with PPP2R2B (PubMed:25816751, PubMed:26496226).
Interacts with PPP2R2A, PPP2R2C and PPP2R2D (PubMed:25816751).
Interacts (via N-terminus) with RPS6KB1 (PubMed:26496226).
Interacts (via central region) with HSF1; this interaction promotes PPP2CA-induced HSF1 dephosphorylation, leading to enhanced HSF1 transcriptional activity (PubMed:25816751, PubMed:26496226, PubMed:26754925).
Homodimer (PubMed:26496226).
Associates with the catalytic subunit of protein phosphatase PP2A (PubMed:25816751, PubMed:26496226).
Interacts (via N- and C-terminal regions) with PPP2R2B (PubMed:25816751, PubMed:26496226).
Interacts with PPP2R2A, PPP2R2C and PPP2R2D (PubMed:25816751).
Interacts (via N-terminus) with RPS6KB1 (PubMed:26496226).
Interacts (via central region) with HSF1; this interaction promotes PPP2CA-induced HSF1 dephosphorylation, leading to enhanced HSF1 transcriptional activity (PubMed:25816751, PubMed:26496226, PubMed:26754925).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q5VY09 | HSF1 Q00613 | 3 | EBI-1774000, EBI-719620 | |
BINARY | Q5VY09 | IER5 Q5VY09 | 2 | EBI-1774000, EBI-1774000 | |
BINARY | Q5VY09 | MINK1 Q8N4C8-4 | 2 | EBI-1774000, EBI-11475194 | |
BINARY | Q5VY09 | RPS6KB1 P23443 | 2 | EBI-1774000, EBI-1775921 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 59-166 | Disordered | ||||
Sequence: GPAGTPAPPPQQQPGEPAAGPPAGWGEPPPPAARASWPETEPQPERSSVSDAPRVGDEVPVATVTGVGDVFQGGEADATEAAWSRVEGPRQAAAREAEGTAGGWGVFP | ||||||
Compositional bias | 60-95 | Pro residues | ||||
Sequence: PAGTPAPPPQQQPGEPAAGPPAGWGEPPPPAARASW | ||||||
Region | 227-313 | Disordered | ||||
Sequence: GPAGCPAPGSTPLKKPRRNLEQPPSGGEDDDAEEMETGNVANLISIFGSSFSGLLRKSPGGGREEEEGEESGPEAAEPGQICCDKPV |
Sequence similarities
Belongs to the IER family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length327
- Mass (Da)33,704
- Last updated2006-10-17 v3
- ChecksumE841C5FAF6520A12
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 60-95 | Pro residues | ||||
Sequence: PAGTPAPPPQQQPGEPAAGPPAGWGEPPPPAARASW | ||||||
Sequence conflict | 161 | in Ref. 2; CAB91983 | ||||
Sequence: G → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF178984 EMBL· GenBank· DDBJ | AAF44348.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ251089 EMBL· GenBank· DDBJ | CAB91983.1 EMBL· GenBank· DDBJ | mRNA | ||
AF258581 EMBL· GenBank· DDBJ | AAG23784.1 EMBL· GenBank· DDBJ | mRNA | ||
AK314830 EMBL· GenBank· DDBJ | BAG37350.1 EMBL· GenBank· DDBJ | mRNA | ||
AL356267 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC000128 EMBL· GenBank· DDBJ | AAH00128.1 EMBL· GenBank· DDBJ | mRNA |