Q5VVH5 · IKBP1_HUMAN
- ProteinInterleukin-1 receptor-associated kinase 1-binding protein 1
- GeneIRAK1BP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids260 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | signaling adaptor activity | |
Biological Process | canonical NF-kappaB signal transduction | |
Biological Process | immune response | |
Biological Process | positive regulation of canonical NF-kappaB signal transduction |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameInterleukin-1 receptor-associated kinase 1-binding protein 1
- Short namesIRAK1-binding protein 1
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5VVH5
Proteomes
Organism-specific databases
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 352 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000313733 | 1-260 | Interleukin-1 receptor-associated kinase 1-binding protein 1 | |||
Sequence: MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHL | ||||||
Modified residue | 56 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 62 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 235 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 237 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 242 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 247 | Phosphothreonine | ||||
Sequence: T |
Post-translational modification
Phosphorylation at Ser-56 and/or Ser-62 is required for full activity. Phosphorylated on at least one of Ser-235, Thr-237, Ser-242 and Thr-247 upon TNF-alpha activation, which favors nuclear translocation (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with IRAK1 and RELA. Interacts with HSPA8 and HSPA1 (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q5VVH5 | MISP Q8IVT2 | 3 | EBI-9658404, EBI-2555085 | |
BINARY | Q5VVH5 | PHF1 O43189 | 3 | EBI-9658404, EBI-530034 | |
BINARY | Q5VVH5 | PRKAB2 O43741 | 3 | EBI-9658404, EBI-1053424 | |
BINARY | Q5VVH5 | RIPPLY1 Q0D2K3 | 3 | EBI-9658404, EBI-10226430 | |
BINARY | Q5VVH5 | SCNM1 Q9BWG6 | 3 | EBI-9658404, EBI-748391 | |
BINARY | Q5VVH5 | TFCP2 Q12800 | 3 | EBI-9658404, EBI-717422 | |
BINARY | Q5VVH5 | USP20 Q9Y2K6 | 3 | EBI-9658404, EBI-2511991 | |
BINARY | Q5VVH5 | ZNF410 Q86VK4-3 | 3 | EBI-9658404, EBI-11741890 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 30-50 | Disordered | ||||
Sequence: GRETLPGLRHPLSSTQAQTAT | ||||||
Region | 240-260 | Required for nuclear localization (NLS) | ||||
Sequence: AASKVFITFEVKGKEKRKKHL |
Domain
The disordered region interacts with HSPA1 and HSPA8.
Sequence similarities
Belongs to the IRAK1BP1 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length260
- Mass (Da)29,106
- Last updated2004-12-07 v1
- ChecksumF8576A4ED9C40352
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL450327 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471051 EMBL· GenBank· DDBJ | EAW48721.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC112253 EMBL· GenBank· DDBJ | AAI12254.1 EMBL· GenBank· DDBJ | mRNA | ||
BC112255 EMBL· GenBank· DDBJ | AAI12256.1 EMBL· GenBank· DDBJ | mRNA |