Q5VSY0 · GKAP1_HUMAN
- ProteinG kinase-anchoring protein 1
- GeneGKAP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids366 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Regulates insulin-dependent IRS1 tyrosine phosphorylation in adipocytes by modulating the availability of IRS1 to IR tyrosine kinase. Its association with IRS1 is required for insulin-induced translocation of SLC2A4 to the cell membrane. Involved in TNF-induced impairment of insulin-dependent IRS1 tyrosine phosphorylation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Golgi apparatus | |
Molecular Function | identical protein binding | |
Biological Process | positive regulation of insulin receptor signaling pathway | |
Biological Process | signal transduction |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameG kinase-anchoring protein 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5VSY0
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 347 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000315654 | 1-366 | UniProt | G kinase-anchoring protein 1 | |||
Sequence: MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEANELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREENWQEWRQRDEQLTSEMFEADLEKALLLSKLEYEEHKKEYEDAENTSTQSKVMNKKDKRKNHQGKDRPLTVSLKDFHSEDHISKKTEELSSSQTLSHDGGFFNRLEDDVHKILIREKRREQLTEYNGTDNCTAHEHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR | |||||||
Modified residue | 23 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 23 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 25 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 25 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 27 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 27 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 106 | UniProt | Phosphoserine; by PKG | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with PRKG1 and IRS1.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q5VSY0 | DYR B0YJ76 | 3 | EBI-743722, EBI-10175413 | |
BINARY | Q5VSY0 | FAM124B Q9H5Z6-2 | 3 | EBI-743722, EBI-11986315 | |
BINARY | Q5VSY0 | GKAP1 Q5VSY0 | 4 | EBI-743722, EBI-743722 | |
BINARY | Q5VSY0 | HDDC3 Q8N4P3 | 3 | EBI-743722, EBI-750003 | |
BINARY | Q5VSY0 | KANK2 Q63ZY3 | 5 | EBI-743722, EBI-2556193 | |
BINARY | Q5VSY0 | KAT5 Q92993 | 3 | EBI-743722, EBI-399080 | |
BINARY | Q5VSY0 | L3MBTL2 Q969R5 | 3 | EBI-743722, EBI-739909 | |
BINARY | Q5VSY0 | MFAP1 P55081 | 3 | EBI-743722, EBI-1048159 | |
BINARY | Q5VSY0 | MMTAG2 Q9BU76 | 3 | EBI-743722, EBI-742459 | |
BINARY | Q5VSY0 | PHOSPHO2 Q8TCD6 | 3 | EBI-743722, EBI-2861380 | |
BINARY | Q5VSY0 | RCOR3 Q9P2K3-2 | 3 | EBI-743722, EBI-1504830 | |
BINARY | Q5VSY0 | SDCBP O00560 | 3 | EBI-743722, EBI-727004 | |
BINARY | Q5VSY0 | ZCCHC10 Q8TBK6 | 3 | EBI-743722, EBI-597063 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, coiled coil, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-95 | Interaction with IRS1 | ||||
Sequence: MASAVLSSVPTTASRFALLQVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEANELRNLAFKKIPQKSSHAVCNAQHD | ||||||
Region | 20-110 | Disordered | ||||
Sequence: QVDSGSGSDSEPGKGKGRNTGKSQTLGSKSTTNEKKREKRRKKKEQQQSEANELRNLAFKKIPQKSSHAVCNAQHDLPLSNPVQKDSREEN | ||||||
Coiled coil | 47-77 | |||||
Sequence: SKSTTNEKKREKRRKKKEQQQSEANELRNLA | ||||||
Compositional bias | 86-105 | Polar residues | ||||
Sequence: SHAVCNAQHDLPLSNPVQKD | ||||||
Coiled coil | 128-160 | |||||
Sequence: ADLEKALLLSKLEYEEHKKEYEDAENTSTQSKV | ||||||
Region | 147-177 | Disordered | ||||
Sequence: EYEDAENTSTQSKVMNKKDKRKNHQGKDRPL | ||||||
Coiled coil | 243-353 | |||||
Sequence: EHNQEVVLKDGRIERLKLELERKDAEIQKLKNVITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGG |
Sequence similarities
Belongs to the GKAP1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q5VSY0-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length366
- Mass (Da)42,078
- Last updated2008-01-15 v2
- Checksum973D16361756691B
Q5VSY0-2
- Name2
- Differences from canonical
- 196-246: Missing
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 86-105 | Polar residues | ||||
Sequence: SHAVCNAQHDLPLSNPVQKD | ||||||
Alternative sequence | VSP_030596 | 196-246 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 325 | in Ref. 2; AAG40320 | ||||
Sequence: Q → R |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB033131 EMBL· GenBank· DDBJ | BAB40454.1 EMBL· GenBank· DDBJ | mRNA | ||
AB033132 EMBL· GenBank· DDBJ | BAB40455.1 EMBL· GenBank· DDBJ | mRNA | ||
AF319476 EMBL· GenBank· DDBJ | AAG40320.1 EMBL· GenBank· DDBJ | mRNA | ||
AL354733 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL662787 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471089 EMBL· GenBank· DDBJ | EAW62665.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CH471089 EMBL· GenBank· DDBJ | EAW62666.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC014476 EMBL· GenBank· DDBJ | AAH14476.1 EMBL· GenBank· DDBJ | mRNA | ||
AK058198 EMBL· GenBank· DDBJ | BAB71712.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |