Q5VPD3 · Q5VPD3_ORYSJ
- ProteinCTP synthase
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids602 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen.
Catalytic activity
- ATP + H2O + L-glutamine + UTP = ADP + CTP + 2 H+ + L-glutamate + phosphate
Pathway
Pyrimidine metabolism; CTP biosynthesis via de novo pathway; CTP from UDP: step 2/2.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 401 | Nucleophile | ||||
Sequence: C | ||||||
Active site | 528 | |||||
Sequence: H | ||||||
Active site | 530 | |||||
Sequence: E |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Molecular Function | ATP binding | |
Molecular Function | CTP synthase activity | |
Molecular Function | identical protein binding | |
Biological Process | 'de novo' CTP biosynthetic process | |
Biological Process | CTP biosynthetic process | |
Biological Process | glutamine metabolic process | |
Biological Process | pyrimidine nucleobase biosynthetic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameCTP synthase
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > Liliopsida > Poales > Poaceae > BOP clade > Oryzoideae > Oryzeae > Oryzinae > Oryza > Oryza sativa
Accessions
- Primary accessionQ5VPD3
- Secondary accessions
Proteomes
Genome annotation databases
PTM/Processing
Proteomic databases
Expression
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 2-272 | CTP synthase N-terminal | ||||
Sequence: KYVLVTGGVVSGLGKGVTASSIGVVLKACGLRVTTIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFLDIKLTRDNNITTGKIYQSVINKERRGDYLGKTIQVVPHITDEIQDWIERVAMNPVDGKEGPPDVCVIELGGTIGDIESMPFIEALGQFSYRVGPGNFCLVHVSLVPVLNVVGEQKTKPTQHSVRGLRGLGLAPDILACRSTEPLEENVKAKLSQFCHVPVSSIINLHDVTNIWHIPLLLRDQRAHEAILKVLDL | ||||||
Domain | 313-546 | Glutamine amidotransferase | ||||
Sequence: SDSYLSVLKALLHASVAMGRKLVVEWVPSCDLEDSAAKETPEAHKKAWKLLKGAEGILVPGGFGDRGVQGKILAAKYARENNVPYLGICLGMQIAVIDFACSIMKLPGANSTEFDPDTMSPCVIFMPEGSKTHMGATMRLGSRRTYFHATACKSAKLYGNARFVDERHRHRYEVNPEMVPEFEKAGLSFVGKDESGRRMEIIELPSHKFFIGVQFHPEFKSRPGKPSPLFLGLI |
Sequence similarities
Belongs to the CTP synthase family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length602
- Mass (Da)66,143
- Last updated2004-12-07 v1
- ChecksumBA52CAEF87355D5E
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0P0V605 | A0A0P0V605_ORYSJ | Os01g0654100 | 43 | ||
A0A0P0V612 | A0A0P0V612_ORYSJ | Os01g0654100 | 299 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AK069482 EMBL· GenBank· DDBJ | BAG91457.1 EMBL· GenBank· DDBJ | mRNA | ||
AP014957 EMBL· GenBank· DDBJ | BAS73479.1 EMBL· GenBank· DDBJ | Genomic DNA |