Q5U4X3 · MEI3A_XENLA
- ProteinHomeobox protein meis3-A
- Genemeis3-a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids453 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Caudalizing protein which is required to pattern the anterior/posterior (A/P) axis during central nervous system (CNS) formation. Inhibits anterior neural expression and acts as a transcriptional activator to induce posterior neural gene expression. Maintains a proper A/P balance required for hindbrain formation by activating the FGF/MAPK pathway, which modulates the planar cell polarity (PCP) pathway. Interacts with retinoid signaling during hindbrain patterning.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 267-329 | Homeobox | ||||
Sequence: RNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPM |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Biological Process | anterior/posterior pattern specification | |
Biological Process | cell differentiation | |
Biological Process | central nervous system development | |
Biological Process | hindbrain development | |
Biological Process | positive regulation of DNA-templated transcription | |
Biological Process | positive regulation of MAPK cascade | |
Biological Process | positive regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHomeobox protein meis3-A
- Short namesXMeis3
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Anura > Pipoidea > Pipidae > Xenopodinae > Xenopus > Xenopus
Accessions
- Primary accessionQ5U4X3
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000355571 | 1-453 | Homeobox protein meis3-A | |||
Sequence: MAQRYDEMLHYPTLDGMPLAGFGDAHTGRALQHHSLSQSAPYGSTGAGHRVPMPPGMGSNDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDNSGSFPGGDVCSSDSFNEDIAVFAKQVRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRDGSSKSDLEDFTGSCTSLSDQNNSWLRDHDETGSAHSGTPGPSSGGLASQSGDNSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGGAPYSPDGQNMGGYVMDGQQHMGIRPPGFQGIPGDYTAAPSTMPMGFPPAGYTPAIPPHSAGLRHGPSLHSYLPGHPHHASMILPAGASPHHLVSAQSPADALLNGQNIDIHAH |
Expression
Tissue specificity
In early-mid neurula stages, expressed in a single stripe in the neural plate. By neurula/early-tailbud stages, expression is localized to rhombomeres r2, r3 and r4 and the anterior spinal cord. Some ventral expression was also detected in posterior rhombomeres. Not expressed in rhombomere r1.
Developmental stage
Initially expressed at gastrula stages. Expression peaks at neurula stage, and is maintained at stable levels through tailbud stages.
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 37-60 | Disordered | ||||
Sequence: SQSAPYGSTGAGHRVPMPPGMGSN | ||||||
Domain | 102-185 | MEIS N-terminal | ||||
Sequence: GGDVCSSDSFNEDIAVFAKQVRTEKPLFSSNPELDSLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIDDRD | ||||||
Region | 206-272 | Disordered | ||||
Sequence: NNSWLRDHDETGSAHSGTPGPSSGGLASQSGDNSSEQGDCMDNSVASPSTGDDDDLDRDKKRNKKRG | ||||||
Compositional bias | 220-255 | Polar residues | ||||
Sequence: HSGTPGPSSGGLASQSGDNSSEQGDCMDNSVASPST |
Sequence similarities
Belongs to the TALE/MEIS homeobox family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q5U4X3-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length453
- Mass (Da)49,116
- Last updated2004-12-07 v1
- ChecksumC3197177D530A8FE
Q5U4X3-2
- Name2
Sequence caution
Features
Showing features for sequence conflict, compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 211 | in Ref. 1; AAD02948 | ||||
Sequence: R → Q | ||||||
Compositional bias | 220-255 | Polar residues | ||||
Sequence: HSGTPGPSSGGLASQSGDNSSEQGDCMDNSVASPST | ||||||
Alternative sequence | VSP_052972 | 368-385 | in isoform 2 | |||
Sequence: FQGIPGDYTAAPSTMPMG → AMGGLGMAVGMEGQWHYM | ||||||
Alternative sequence | VSP_052973 | 386-453 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF072895 EMBL· GenBank· DDBJ | AAD02948.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BC084920 EMBL· GenBank· DDBJ | AAH84920.1 EMBL· GenBank· DDBJ | mRNA |