Q5U4N7 · GDAS1_HUMAN
- ProteinProtein GDF5-AS1, mitochondrial
- GeneGDF5-AS1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids250 (go to sequence)
- Protein existenceUncertain
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrion |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein GDF5-AS1, mitochondrial
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5U4N7
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, modified residue (large scale data), chain.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Transit peptide | 1-48 | UniProt | Mitochondrion | ||||
Sequence: MIQSSQPMSLKLTCSAFRLQRALRFLLGRLPWRVASGARRFRRWLNRY | |||||||
Modified residue (large scale data) | 15 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Chain | PRO_0000289167 | 49-250 | UniProt | Protein GDF5-AS1, mitochondrial | |||
Sequence: SYTVLSSWPERALISLKNRSRFLVRPNTRNRAFSWTCRAARSKPRPRRSTALPRSQASSSRHSWAEFLKFRKSFQMSNTSQPDPSRPGTERTSSKEAGCRPLGQLDSFSWAARPPPGAAGLAVSEGFFRKIRSSAPSSPSFSRALMSNTYLCFLTTGPRSSRENTQKSFPATSPREPVTSRLRGKAPALSPSRELSFTSAPF |
Proteomic databases
PTM databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q5U4N7 | RHBDD2 Q6NTF9-3 | 3 | EBI-17590774, EBI-17589229 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 86-108 | Disordered | ||||
Sequence: RAARSKPRPRRSTALPRSQASSS | ||||||
Compositional bias | 124-140 | Polar residues | ||||
Sequence: MSNTSQPDPSRPGTERT | ||||||
Region | 124-148 | Disordered | ||||
Sequence: MSNTSQPDPSRPGTERTSSKEAGCR | ||||||
Compositional bias | 204-223 | Polar residues | ||||
Sequence: TGPRSSRENTQKSFPATSPR | ||||||
Region | 204-250 | Disordered | ||||
Sequence: TGPRSSRENTQKSFPATSPREPVTSRLRGKAPALSPSRELSFTSAPF |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length250
- Mass (Da)28,211
- Last updated2009-05-05 v2
- Checksum11AEE309332C6EE5
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 124-140 | Polar residues | ||||
Sequence: MSNTSQPDPSRPGTERT | ||||||
Sequence conflict | 144 | in Ref. 2; AAH85019 | ||||
Sequence: E → A | ||||||
Compositional bias | 204-223 | Polar residues | ||||
Sequence: TGPRSSRENTQKSFPATSPR |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL121586 EMBL· GenBank· DDBJ | CAO03344.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC085019 EMBL· GenBank· DDBJ | AAH85019.1 EMBL· GenBank· DDBJ | mRNA |