Q5U2Y1 · GTF2I_RAT
- ProteinGeneral transcription factor II-I
- GeneGtf2i
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids979 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Interacts with the basal transcription machinery by coordinating the formation of a multiprotein complex at the C-FOS promoter, and linking specific signal responsive activator complexes. Promotes the formation of stable high-order complexes of SRF and PHOX1 and interacts cooperatively with PHOX1 to promote serum-inducible transcription of a reporter gene deriven by the C-FOS serum response element (SRE). Acts as a coregulator for USF1 by binding independently two promoter elements, a pyrimidine-rich initiator (Inr) and an upstream E-box (By similarity).
Required for the formation of functional ARID3A DNA-binding complexes and for activation of immunoglobulin heavy-chain transcription upon B-lymphocyte activation (By similarity).
Required for the formation of functional ARID3A DNA-binding complexes and for activation of immunoglobulin heavy-chain transcription upon B-lymphocyte activation (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | RNA polymerase II-specific DNA-binding transcription factor binding | |
Biological Process | negative regulation of angiogenesis | |
Biological Process | negative regulation of cytosolic calcium ion concentration | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameGeneral transcription factor II-I
- Short namesGTFII-I; TFII-I
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionQ5U2Y1
- Secondary accessions
Proteomes
Organism-specific databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000343749 | 2-979 | General transcription factor II-I | |||
Sequence: AQVAMSALPAEDEESSESRMVVTFLMSALESMCKELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKCTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVAVQGLPEGVAFKHPEHYDLATLKWILENKAGISFIIKRPFLEPKKHLGGRVMAADADRPMLSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGAEVEVPAEDSTQHVPSETSEDPEVEVTIEDDDYSPPTKRPKSSEPPPPPPVPEPTNAGKRKVREFNFEKWNARITDLRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLERILLAKERIRFVIKKHELLNSTREDLQLDKPASGVKEEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAYPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEVTQPRTNTPVKEDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVVSYLPPGMASKINTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNSPQTSTVRTPTQTNGSNVPFKPRGREFSFEAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKESTSSKSPPRKTNSSPSVNTTASGVEDLNIIQVTIPDDDNERLSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMPPGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQLVDQNESEGPVIQESAEASQLEVPATEEIKETDGSSQIKQEPDPTW | ||||||
Modified residue | 19 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 35 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 86 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 92 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 94 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 103 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 130 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 130 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Cross-link | 140 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 185 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 210 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 214 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 219 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 221 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | ||||||
Cross-link | 221 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Modified residue | 228 | In isoform Q5U2Y1-2; Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 248 | Phosphotyrosine; by BTK | ||||
Sequence: Y | ||||||
Cross-link | 306 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 324 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 334 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 334 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Cross-link | 361 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 379 | Phosphotyrosine; by BTK | ||||
Sequence: Y | ||||||
Modified residue | 393 | Phosphoserine; by PKG/PRKG1 | ||||
Sequence: S | ||||||
Cross-link | 416 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 431 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 431 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Cross-link | 437 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 469 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 475 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 484 | Phosphotyrosine; by BTK | ||||
Sequence: Y | ||||||
Modified residue | 498 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 507 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 537 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 539 | Phosphothreonine | ||||
Sequence: T | ||||||
Cross-link | 542 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 641 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 645 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 649 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 651 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 655 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 661 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 696 | N6-acetyllysine; alternate | ||||
Sequence: K | ||||||
Cross-link | 696 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K | ||||||
Modified residue | 703 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 765 | Phosphoserine; by PKG/PRKG1 | ||||
Sequence: S | ||||||
Cross-link | 797 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 804 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 808 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 842 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 845 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 860 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 872 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 972 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternate | ||||
Sequence: K | ||||||
Cross-link | 972 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternate | ||||
Sequence: K |
Post-translational modification
Transiently phosphorylated on tyrosine residues by BTK in response to B-cell receptor stimulation. Phosphorylation on Tyr-248 and Tyr-379, and perhaps, on Tyr-484 contributes to BTK-mediated transcriptional activation (By similarity).
Sumoylated.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Homodimer (Potential). Interacts with SRF and PHOX1. Binds a pyrimidine-rich initiator (Inr) and a recognition site (E-box) for upstream stimulatory factor 1 (USF1). Associates with the PH domain of Bruton's tyrosine kinase (BTK) (By similarity).
May be a component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST, PHF21A/BHC80, ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Interacts with BTK and ARID3A (By similarity).
Interacts with isoform beta of PRKG1 (By similarity).
May be a component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST, PHF21A/BHC80, ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. Interacts with BTK and ARID3A (By similarity).
Interacts with isoform beta of PRKG1 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for repeat, region, motif, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Repeat | 103-197 | GTF2I-like 1 | ||||
Sequence: SVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVAVQGLPEGVAFKHPEHYDLATLKWILENKAGISFIIKRPFLEPKKHLGG | ||||||
Region | 205-231 | Disordered | ||||
Sequence: DRPMLSPGGSCGPIKVKTEPTEDSGIS | ||||||
Region | 250-325 | Disordered | ||||
Sequence: QYNIQGSHHSSEGNEGAEVEVPAEDSTQHVPSETSEDPEVEVTIEDDDYSPPTKRPKSSEPPPPPPVPEPTNAGKR | ||||||
Motif | 300-307 | Nuclear localization signal | ||||
Sequence: PPTKRPKS | ||||||
Compositional bias | 304-320 | Pro residues | ||||
Sequence: RPKSSEPPPPPPVPEPT | ||||||
Repeat | 333-427 | GTF2I-like 2 | ||||
Sequence: EKWNARITDLRKQVEELFERKYAQAIKAKGPVTIPYPLFQSHVEDLYVEGLPEGIPFRRPSTYGIPRLERILLAKERIRFVIKKHELLNSTREDL | ||||||
Repeat | 438-532 | GTF2I-like 3 | ||||
Sequence: EEWYARITKLRKMVDQLFCKKFAEALGSTEAKAVPYQKFEAYPNDLYVEGLPENIPFRSPSWYGIPRLEKIIQVGNRIKFVIKRPELLTHSTTEV | ||||||
Repeat | 543-637 | GTF2I-like 4 | ||||
Sequence: EDWNVRITKLRKQVEEIFNLKFAQALGLTEAVKVPYPVFESNPEFLYVEGLPEGIPFRSPTWFGIPRLERIVRGSNKIKFVVKKPELVVSYLPPG | ||||||
Compositional bias | 642-656 | Polar residues | ||||
Sequence: INTKALQSPKRPRSP | ||||||
Region | 642-695 | Disordered | ||||
Sequence: INTKALQSPKRPRSPGSNSKVPEIEVTVEGPNNNSPQTSTVRTPTQTNGSNVPF | ||||||
Compositional bias | 669-694 | Polar residues | ||||
Sequence: VEGPNNNSPQTSTVRTPTQTNGSNVP | ||||||
Repeat | 705-799 | GTF2I-like 5 | ||||
Sequence: EAWNAKITDLKQKVENLFNEKCGEALGLKQAVKVPFALFESFPEDFYVEGLPEGVPFRRPSTFGIPRLEKILRNKAKIKFIIKKPEMFETAIKES | ||||||
Region | 797-818 | Disordered | ||||
Sequence: KESTSSKSPPRKTNSSPSVNTT | ||||||
Repeat | 840-934 | GTF2I-like 6 | ||||
Sequence: LSKVEKARQLREQVNDLFSRKFGEAIGMGFPVKVPYRKITINPGCVVVDGMPPGVSFKAPSYLEISSMRRILDSAEFIKFTVIRPFPGLVINNQL | ||||||
Region | 940-979 | Disordered | ||||
Sequence: SEGPVIQESAEASQLEVPATEEIKETDGSSQIKQEPDPTW |
Sequence similarities
Belongs to the TFII-I family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q5U2Y1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length979
- Mass (Da)110,215
- Last updated2008-07-22 v2
- Checksum82D35A08122C210D
Q5U2Y1-2
- Name2
- Differences from canonical
- 229-294: Missing
Computationally mapped potential isoform sequences
There are 8 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0G2K4T7 | A0A0G2K4T7_RAT | Gtf2i | 999 | ||
A0A8I6ALH4 | A0A8I6ALH4_RAT | Gtf2i | 960 | ||
A0A8I6AST1 | A0A8I6AST1_RAT | Gtf2i | 978 | ||
A0A8I6GKF6 | A0A8I6GKF6_RAT | Gtf2i | 272 | ||
A0A8I5ZK57 | A0A8I5ZK57_RAT | Gtf2i | 904 | ||
A0A8I5ZK83 | A0A8I5ZK83_RAT | Gtf2i | 953 | ||
A0A1B0GWN0 | A0A1B0GWN0_RAT | Gtf2i | 992 | ||
A0A8I5ZRM5 | A0A8I5ZRM5_RAT | Gtf2i | 939 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_034698 | 229-294 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 304-320 | Pro residues | ||||
Sequence: RPKSSEPPPPPPVPEPT | ||||||
Compositional bias | 642-656 | Polar residues | ||||
Sequence: INTKALQSPKRPRSP | ||||||
Compositional bias | 669-694 | Polar residues | ||||
Sequence: VEGPNNNSPQTSTVRTPTQTNGSNVP |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF547390 EMBL· GenBank· DDBJ | AAO32678.1 EMBL· GenBank· DDBJ | mRNA | ||
AF547391 EMBL· GenBank· DDBJ | AAO32679.1 EMBL· GenBank· DDBJ | mRNA | ||
BC085815 EMBL· GenBank· DDBJ | AAH85815.1 EMBL· GenBank· DDBJ | mRNA |