Q5TBB1 · RNH2B_HUMAN
- ProteinRibonuclease H2 subunit B
- GeneRNASEH2B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids312 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleoplasm | |
Cellular Component | ribonuclease H2 complex | |
Biological Process | fibroblast proliferation | |
Biological Process | gene expression | |
Biological Process | in utero embryonic development | |
Biological Process | mismatch repair | |
Biological Process | negative regulation of gene expression | |
Biological Process | positive regulation of fibroblast proliferation | |
Biological Process | regulation of DNA damage checkpoint | |
Biological Process | regulation of G2/M transition of mitotic cell cycle | |
Biological Process | ribonucleotide metabolic process | |
Biological Process | RNA catabolic process |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRibonuclease H2 subunit B
- Short namesRNase H2 subunit B
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionQ5TBB1
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Aicardi-Goutieres syndrome 2 (AGS2)
- Note
- DescriptionA form of Aicardi-Goutieres syndrome, a genetically heterogeneous disease characterized by cerebral atrophy, leukoencephalopathy, intracranial calcifications, chronic cerebrospinal fluid (CSF) lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infection. Clinical features as thrombocytopenia, hepatosplenomegaly and elevated hepatic transaminases along with intermittent fever may erroneously suggest an infective process. Severe neurological dysfunctions manifest in infancy as progressive microcephaly, spasticity, dystonic posturing and profound psychomotor retardation. Death often occurs in early childhood.
- See alsoMIM:610181
Natural variants in AGS2
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_070611 | 43 | P>H | in AGS2; dbSNP:rs79564863 | |
VAR_027280 | 60 | L>R | in AGS2; heterozygous compound with T-177; dbSNP:rs75325951 | |
VAR_070612 | 73 | W>L | in AGS2; reduces stability of the RNase complex; dbSNP:rs78071087 | |
VAR_070613 | 83 | G>S | in AGS2; reduces stability of the RNase complex; dbSNP:rs76158094 | |
VAR_027281 | 86 | H>R | in AGS2; heterozygous compound with T-177; reduces stability of the RNase complex; dbSNP:rs77931005 | |
VAR_070614 | 138 | L>F | in AGS2; dbSNP:rs78705382 | |
VAR_070615 | 159 | S>I | in AGS2; dbSNP:rs76219783 | |
VAR_027282 | 162 | K>T | in AGS2; dbSNP:rs75971463 | |
VAR_027283 | 163 | T>I | in AGS2; heterozygous compound with T-177; dbSNP:rs79310911 | |
VAR_027284 | 177 | A>T | in AGS2; frequent mutation; dbSNP:rs75184679 | |
VAR_070616 | 183 | V>M | in AGS2; dbSNP:rs77377571 | |
VAR_027285 | 185 | V>G | in AGS2; dbSNP:rs74555752 | |
VAR_027286 | 219 | Y>H | in AGS2; heterozygous compound with a nonsense mutation; reduces stability of the RNase complex; dbSNP:rs77391331 | |
VAR_070617 | 229 | S>P | in AGS2; dbSNP:rs768565639 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_070611 | 43 | in AGS2; dbSNP:rs79564863 | |||
Sequence: P → H | ||||||
Natural variant | VAR_027280 | 60 | in AGS2; heterozygous compound with T-177; dbSNP:rs75325951 | |||
Sequence: L → R | ||||||
Natural variant | VAR_070612 | 73 | in AGS2; reduces stability of the RNase complex; dbSNP:rs78071087 | |||
Sequence: W → L | ||||||
Natural variant | VAR_070613 | 83 | in AGS2; reduces stability of the RNase complex; dbSNP:rs76158094 | |||
Sequence: G → S | ||||||
Natural variant | VAR_027281 | 86 | in AGS2; heterozygous compound with T-177; reduces stability of the RNase complex; dbSNP:rs77931005 | |||
Sequence: H → R | ||||||
Natural variant | VAR_070614 | 138 | in AGS2; dbSNP:rs78705382 | |||
Sequence: L → F | ||||||
Natural variant | VAR_070615 | 159 | in AGS2; dbSNP:rs76219783 | |||
Sequence: S → I | ||||||
Natural variant | VAR_027282 | 162 | in AGS2; dbSNP:rs75971463 | |||
Sequence: K → T | ||||||
Natural variant | VAR_027283 | 163 | in AGS2; heterozygous compound with T-177; dbSNP:rs79310911 | |||
Sequence: T → I | ||||||
Natural variant | VAR_027284 | 177 | in AGS2; frequent mutation; dbSNP:rs75184679 | |||
Sequence: A → T | ||||||
Natural variant | VAR_070616 | 183 | in AGS2; dbSNP:rs77377571 | |||
Sequence: V → M | ||||||
Natural variant | VAR_027285 | 185 | in AGS2; dbSNP:rs74555752 | |||
Sequence: V → G | ||||||
Natural variant | VAR_027286 | 219 | in AGS2; heterozygous compound with a nonsense mutation; reduces stability of the RNase complex; dbSNP:rs77391331 | |||
Sequence: Y → H | ||||||
Natural variant | VAR_070617 | 229 | in AGS2; dbSNP:rs768565639 | |||
Sequence: S → P |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 402 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000248378 | 2-312 | UniProt | Ribonuclease H2 subunit B | |||
Sequence: AAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKHHSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHHVTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIRYAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKKIKLSDEPVEAKEDYTKFNTKDLKTEKKNSKMTAAQKALAKVDKSGMKSIDTFFGVKNKKKIGKV | |||||||
Modified residue (large scale data) | 252 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 295 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue | 296 | UniProt | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed.
Gene expression databases
Organism-specific databases
Interaction
Subunit
The RNase H2 complex is a heterotrimer composed of the catalytic subunit RNASEH2A and the non-catalytic subunits RNASEH2B and RNASEH2C.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | Q5TBB1 | ZMYM3 Q14202 | 4 | EBI-9027329, EBI-2556139 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 236-256 | Disordered | ||||
Sequence: EPSASLPNPPSKKIKLSDEPV |
Sequence similarities
Belongs to the RNase H2 subunit B family.
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
Q5TBB1-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length312
- Mass (Da)35,139
- Last updated2005-04-12 v1
- Checksum98B1A8E073A50D68
Q5TBB1-2
- Name2
Computationally mapped potential isoform sequences
There are 34 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2R8Y7Q3 | A0A2R8Y7Q3_HUMAN | RNASEH2B | 268 | ||
A0A2R8Y883 | A0A2R8Y883_HUMAN | RNASEH2B | 266 | ||
A0A2R8Y7M7 | A0A2R8Y7M7_HUMAN | RNASEH2B | 81 | ||
A0A2R8Y7R8 | A0A2R8Y7R8_HUMAN | RNASEH2B | 355 | ||
A0A2R8Y7A3 | A0A2R8Y7A3_HUMAN | RNASEH2B | 47 | ||
A0A2R8Y6Y1 | A0A2R8Y6Y1_HUMAN | RNASEH2B | 320 | ||
A0A2R8Y6Q6 | A0A2R8Y6Q6_HUMAN | RNASEH2B | 300 | ||
A0A2R8Y6U1 | A0A2R8Y6U1_HUMAN | RNASEH2B | 33 | ||
A0A2R8Y761 | A0A2R8Y761_HUMAN | RNASEH2B | 289 | ||
A0A2R8Y6M7 | A0A2R8Y6M7_HUMAN | RNASEH2B | 263 | ||
A0A2R8Y459 | A0A2R8Y459_HUMAN | RNASEH2B | 164 | ||
A0AAQ5BI53 | A0AAQ5BI53_HUMAN | RNASEH2B | 121 | ||
A0AAQ5BHA0 | A0AAQ5BHA0_HUMAN | RNASEH2B | 57 | ||
A0AAQ5BHA8 | A0AAQ5BHA8_HUMAN | RNASEH2B | 319 | ||
A0AAQ5BH34 | A0AAQ5BH34_HUMAN | RNASEH2B | 105 | ||
A0AAQ5BH45 | A0AAQ5BH45_HUMAN | RNASEH2B | 169 | ||
A0A2R8Y687 | A0A2R8Y687_HUMAN | RNASEH2B | 269 | ||
A0AAQ5BH87 | A0AAQ5BH87_HUMAN | RNASEH2B | 51 | ||
A0AAQ5BH61 | A0AAQ5BH61_HUMAN | RNASEH2B | 188 | ||
A0A2R8Y4Y9 | A0A2R8Y4Y9_HUMAN | RNASEH2B | 92 | ||
A0A2R8Y4S2 | A0A2R8Y4S2_HUMAN | RNASEH2B | 272 | ||
A0A2R8YGP2 | A0A2R8YGP2_HUMAN | RNASEH2B | 309 | ||
A0A2R8YEB4 | A0A2R8YEB4_HUMAN | RNASEH2B | 128 | ||
A0A2R8YEC1 | A0A2R8YEC1_HUMAN | RNASEH2B | 227 | ||
A0A2R8YE60 | A0A2R8YE60_HUMAN | RNASEH2B | 243 | ||
A0A2R8YCX2 | A0A2R8YCX2_HUMAN | RNASEH2B | 273 | ||
A0A2R8YCP1 | A0A2R8YCP1_HUMAN | RNASEH2B | 254 | ||
A0A2R8YCJ4 | A0A2R8YCJ4_HUMAN | RNASEH2B | 293 | ||
A0A2R8YEU9 | A0A2R8YEU9_HUMAN | RNASEH2B | 104 | ||
A0A2R8YEQ4 | A0A2R8YEQ4_HUMAN | RNASEH2B | 48 | ||
A0A2R8YEK5 | A0A2R8YEK5_HUMAN | RNASEH2B | 76 | ||
A0A2R8YEH2 | A0A2R8YEH2_HUMAN | RNASEH2B | 324 | ||
A0A087WXR7 | A0A087WXR7_HUMAN | RNASEH2B | 282 | ||
A0A087WZJ6 | A0A087WZJ6_HUMAN | RNASEH2B | 289 |
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AY764036 EMBL· GenBank· DDBJ | AAX13343.1 EMBL· GenBank· DDBJ | mRNA | ||
AK021774 EMBL· GenBank· DDBJ | BAB13892.1 EMBL· GenBank· DDBJ | mRNA | ||
AK223340 EMBL· GenBank· DDBJ | BAD97060.1 EMBL· GenBank· DDBJ | mRNA | ||
AL137881 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471075 EMBL· GenBank· DDBJ | EAX08864.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001397 EMBL· GenBank· DDBJ | AAH01397.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC005088 EMBL· GenBank· DDBJ | AAH05088.1 EMBL· GenBank· DDBJ | mRNA | ||
BC007332 EMBL· GenBank· DDBJ | AAH07332.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. | |
BC010174 EMBL· GenBank· DDBJ | AAH10174.1 EMBL· GenBank· DDBJ | mRNA | Sequence problems. |